CAZyme Information: KAG1705285.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1705285.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		43342.26	5.7282

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000013:454904-456091(+)

Full Sequence      

MKMFLFPVIGAALASVTAAKDLPYSTRMIDSVISRQQGVVSSGAVTSTLESGVLTLAIQS
WLNTYSKSEDSTRVANFTTYADSIVTSISPSFKGPEAAAKMPLDRLTIGQALLDINATEG
TLTTPESETLTLLNNSLILQNRNQYNGFWYYVYQNWSYLDGTVSFLPYMAAAPGWSYEDM
LLQIELLYLNTYNQSTALVVHGYDASKTAVWANKKTGASPYVWGRSLGWYLAGLVNAWEK
IGDCQGDVNCQKLTAAIELQFSQLCRSIVKYADKATGVWWQLPTLGGKKGNFLESSSTML
YTFSILKGLRLGLLKEKSQELQAAAMKAYDYTVNSGAFLLDYHNGTLGWNGTVTVCSLNS
TATYEYYVGRPIVHNHALGEGAFILASLEVEQLAQ

Enzyme Prediction     

No EC number prediction in KAG1705285.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	392	1.6e-45	0.9397590361445783

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	4.45e-26	141	394	115	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.91e-24	103	393	72	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26402.1|GH105	3.66e-201	2	394	3	402
UQC88631.1|GH105	9.20e-115	28	392	1	359
QLI72757.1|GH105	9.15e-109	25	394	12	378
QLI74420.1|GH105	2.24e-107	13	394	9	391
UNI22131.1|GH105	1.09e-103	5	393	1	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.59e-35	103	393	74	361	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.33e-33	141	393	123	367	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.60e-33	141	393	113	357	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	2.23e-32	141	393	123	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	5.30e-19	178	395	20	233	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	5.30e-19	178	395	20	233	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999733	CS pos: 19-20. Pr: 0.8240

TMHMM  Annotations     

There is no transmembrane helices in KAG1705285.1.