CAZyme Information: KAG1705034.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1705034.1
• CAZy Family: GT10
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
533	JADEVP010000014|CGC6	59395.61	4.5417

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000014:897924-899525(+)

Full Sequence      

MKIQAAVAGLLSLASFTSITSAADPSWHNLAITAPQYGRYLTRTASDEPFFWQADTAWEL
VHRLNKTSIDFYLKTRAEQGYNVVQTVLVSELDGTTRPNFYGDLPFNNSDPTKPNEAYFE
LVDWTVDLAASYGILMALVPTWGMYVNSGWHSTTPIFNESNAYEWGKYVGNRYPGLPKIL
GGDSNVLWSWNISKVQAAYAEDPDQDLPSLLAPIEDTSSVWASMRAGLKESEKTQNYEAV
VIYHPTAGWIVKPEVTPEPYGHNMLGDEEDRMSIDAVQSGHSTPDPTSKFTPAVGWDSTK
NYELIANMRDRFTGPVLDLENHYEGAHDSFSLTRQIWNSSQVRTGLYHGVYSGATGFTYG
ANSVWQMYEPRADLLSDANYYDPQINQNASGSWREDIYFEGATQIQYVTKPLQNLTTAVL
ESLEPAREILSSPTGHTGKSVNTYEGTRYLSILASKNRDRYYVYTGHGDSFALQLDNGSG
VRTGNARWFSPRDGQYTAASTVRVPESGDATRIDFTPPSTGGVDNDWLLVLEF

Enzyme Prediction     

No EC number prediction in KAG1705034.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	38	527	9.1e-80	0.9733009708737864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	3.65e-122	38	415	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	3.21e-14	446	532	12	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	3.36e-172	6	532	3	534
KAF3763706.1|GH140	1.08e-162	18	531	18	535
KNX49908.1|GH140	3.43e-82	29	528	13	514
KAE8156220.1|GH140	1.51e-76	31	532	28	508
KAB8276359.1|GH140	1.23e-74	31	532	28	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	8.85e-25	27	495	13	414	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	2.43e-22	27	495	13	414	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

KAG1705034.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000275	0.999710	CS pos: 22-23. Pr: 0.9766

TMHMM  Annotations     

There is no transmembrane helices in KAG1705034.1.