CAZyme Information: KAG1704047.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1704047.1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		47803.09	8.8551

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000016:130654-132401(-)

Full Sequence      

MSRRTLALFGGALALRLVLLLYGHLQDLYMSVKYTDVDYDVYSDAAREIAQGNSPFERTT
YRYTPALALMLLPNIFVHEVFGKLLFVGCDLLVGYILYQILRLRGLPDTSAANYCCVWLF
HPFSVNISTRGNADSIVVLLVMLSLLLIMRKQLVLSALAYGAAVHFKVYPIIYALAFLVF
LNEDFRAANAKWASSSSCFWAQLAGQLNRDRLVFGLVSGGLFIFLAAGFYYLYGFQFLYE
TYLYHFTRTDNRHNFSVYFYGLYLRYNTPSGFGVGLIAFFPQLASLLAISFVYGRDLPFA
LFALTMVFVIFNKVCTAQYFLWYTAFLPLIFPLTSVKFKWQGLGMIIAWLGGELHWLYWA
YQLEMQGVNTFSPLWMAGLAFFSVNVGILATLMRHHSFTPLFRDGDVLQLVPSNRLKED

Enzyme Prediction     

No EC number prediction in KAG1704047.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	127	392	1e-90	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	3.92e-134	22	407	25	429	GPI mannosyltransferase
252941	Mannosyl_trans	6.34e-71	127	393	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18245.1|GT50	1.70e-150	16	407	16	407
VDD20265.1|GT50	2.78e-117	1	415	1	416
VDC86084.1|GT50	1.40e-115	1	415	15	430
CAG7892072.1|GT50	1.40e-115	1	415	15	430
BBN20063.1|GT50	2.47e-115	2	405	33	440

PDB Hits     

KAG1704047.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q500W7|PIGM_ARATH	4.25e-115	1	403	16	435	GPI mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PIGM PE=2 SV=1
sp|Q5RAH7|PIGM_PONAB	8.53e-111	9	401	22	416	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q9H3S5|PIGM_HUMAN	8.53e-111	9	401	22	416	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q4R4E1|PIGM_MACFA	2.41e-110	9	401	22	416	GPI mannosyltransferase 1 OS=Macaca fascicularis OX=9541 GN=PIGM PE=2 SV=1
sp|Q66IJ4|PIGM_XENTR	2.19e-107	8	396	17	409	GPI mannosyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=pigm PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000010

TMHMM  Annotations     

Start	End
7	26
75	97
135	149
159	181
212	234
271	293
300	322
342	359
371	393