CAZyme Information: KAG1703555.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1703555.1
• CAZy Family: GH78
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295	JADEVP010000018|CGC6	32827.68	4.8304

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000018:715565-716452(-)

Full Sequence      

MAEGMLYLPNTTEEHTLFVFPGLYQEQVVIPKLAGPLVLQGYSCDATSYASNQVTITHTM
AQKDLPPEVKNNRNDLISTMRLKSRNGVKIYNLNVANPAGPIENLGQAVAVYADATNYGF
YGCSFTGFQDTLCAHRGRQLYARTHISGTIDFIFGMRAMAWFESCDIETIGEGGWITANG
NTNSTIQSEYVFNRARVFGSSGNSSTFLGRPWRPYARVVWQNSELGDVVNPKGWDTWNDD
NKTENVYFKEFNNTGLGAAIDQRVTFSGQLNAPVGITEILGEGFESEWWVDKSYL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	11	271	4.6e-68	0.8576388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	8.12e-45	97	268	98	276	Pectinesterase.
215383	PLN02713	1.12e-39	9	268	273	529	Probable pectinesterase/pectinesterase inhibitor
178372	PLN02773	1.60e-39	19	270	39	282	pectinesterase
178113	PLN02497	8.76e-39	17	292	64	328	probable pectinesterase
178051	PLN02432	3.37e-38	9	272	35	274	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54872.1|CE8|3.1.1.11	1.26e-223	1	295	54	348
ACO54874.1|CE8	7.40e-177	1	295	55	348
ACO54870.1|CE8	9.69e-168	1	295	52	347
ABQ63096.1|CE8	2.07e-145	1	295	52	344
ACO54873.1|CE8	6.86e-144	1	295	52	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.03e-55	1	294	22	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.45e-55	1	294	22	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.32e-31	1	268	22	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	9.51e-30	1	268	18	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	9.04e-10	107	262	129	315	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	8.47e-71	10	295	50	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	4.29e-68	10	294	50	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A1DBT4|PMEA_NEOFI	3.45e-59	8	294	54	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.37e-58	1	294	47	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.37e-58	1	294	47	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG1703555.1.