CAZyme Information: KAG1703275.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1703275.1
• CAZy Family: GH78
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790		85898.81	4.2318

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000019:653622-655994(+)

Full Sequence      

MFTNWLFIVAVLLRPVFASSGSTGDNLDSEAQTIVDSFSTDQVIGQMCQLDITMVLNEDH
SVNETLVRQFAKLGIGAYLNSPFAGWNATGWRNIIKEIQTYHMDENGGHPMVYGLDSVHG
AQYVDKAVLFPQQINAGASFNPDLARQMGFVTGRDTAAAGISWVLGPILDISYNPLWTRT
FETFGEDPYLASVLGAAYIQGVQNNSQSGACMKHFIGYSQTATGVDREGVTISDFDLLNY
HVPAFKAGIEHGAMSTMENYVSLNGVPIVSSTKILHNLLRDDLEFNGVVVTDWGEVNNLQ
SWHRVVRTQQDAVELVIANTSLDMSMVPLSTDFIDQAKYVLGNNSDYEDRLRSSAKRIIK
MKLQMGLYDTPVPGESDVDLVGNEDDQEQALNLARESIVLLKNDDNLLPLAKGVSVFLTG
FSIDDIGFQCGGWSIYWQGTSGNQYFAHGMSVREGIEKLVGNDSVTYFNGLNSDGTYSEE
DLSTATGYASDADVVIVAIGEAPYAEKWGDINELTLPSGQLEYVQALANTGKKVILILFE
GRPRLLGSLPDSVTAVVWGGLPCEQGGQAMAEILFGDVNPSGKLPITYPKYSGHIMIPYY
HRVSTQCSYGACEMQWDFGAGLSYTNFSYSDLTLSTSKITSMDASITVSVTVANNGTMAG
KETVMLFLIQPYRAVAVPEVKMLCKFEKIELQAGASTTVTFTLTADDWSVYKPQIGNGLK
QEAENGEFVVAIGPKTNCDVYNDAGMSNELCANFTLAADSTSVGETISSASITEMTCWMT
ALSLLLALLS

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	106	317	1.4e-61	0.9351851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.34e-104	110	733	105	751	beta-glucosidase BglX.
224389	BglX	2.11e-65	39	458	2	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.42e-53	124	703	108	742	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	5.66e-50	398	624	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.48e-48	39	359	1	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	1.40e-310	1	756	1	762
CCA27737.1|GH3	6.31e-283	29	756	66	808
UIZ29613.1|GH3	1.06e-282	1	758	46	821
UIZ27116.1|GH3	2.98e-272	47	756	1	724
UIZ29432.1|GH3	4.17e-268	1	758	1	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.30e-129	23	733	9	740	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
4ZOA_A	2.14e-76	30	715	5	692	Crystal Structure of beta-glucosidase from Listeria innocua in complex with isofagomine [Listeria innocua Clip11262],4ZOA_B Crystal Structure of beta-glucosidase from Listeria innocua in complex with isofagomine [Listeria innocua Clip11262],4ZOB_A Crystal Structure of beta-glucosidase from Listeria innocua in complex with gluconolactone [Listeria innocua Clip11262],4ZOB_B Crystal Structure of beta-glucosidase from Listeria innocua in complex with gluconolactone [Listeria innocua Clip11262],4ZOD_A Crystal Structure of beta-glucosidase from Listeria innocua in complex with glucose [Listeria innocua Clip11262],4ZOD_B Crystal Structure of beta-glucosidase from Listeria innocua in complex with glucose [Listeria innocua Clip11262],4ZOE_A Crystal Structure of beta-glucosidase from Listeria innocua [Listeria innocua Clip11262],4ZOE_B Crystal Structure of beta-glucosidase from Listeria innocua [Listeria innocua Clip11262]
5M6G_A	3.61e-76	39	588	59	587	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
7EAP_A	2.02e-75	27	733	14	742	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	2.02e-75	27	733	14	742	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	8.80e-150	28	733	77	812	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	9.71e-129	23	733	31	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	1.44e-81	94	739	50	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	8.75e-80	9	733	11	751	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	3.22e-79	12	733	19	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999726	CS pos: 18-19. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in KAG1703275.1.