CAZyme Information: KAG1703193.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1703193.1
• CAZy Family: GH78
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		84693.14	4.2844

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000019:464615-466948(+)

Full Sequence      

MLKTWLLAIICTALGLATGTTADNFDTQAEAIVANFTTDQVLGQMAQIPLYLFTNADATL
NETLFRNYAKLKVGSYNLVAFNDAPNSITGAYGWTAAEWRDVITRMQEIAMEENDGVPFV
YALDSVRGANHVVNATMFGAQINAGASFNSDLVYEQGRITGQDTRAAGISWVMGPVLELS
HNPLWPRTFETFGEDPYLVSIMAEMITKGLQSSNETAACLKHFVAYSKTDTGHDQDGVSI
SDFDLLNYYLPPFKRSMEAGALSTMENYISVNGIPTIANHRILQVLLREDIGFEGVTLSD
FAEIGMMNTFHRVARNASEAVRFSYTNTGIDVAMGSDTTYLNGSKLLVQESPEYLERMRE
TAKRVIKMKLQLGLFDTPVPGADDVEKVHNEDDIATALDMARESIVLLQNNGSTLPILSS
SSVFLTGHSADNIGNQCGGVSIFWHGYSGNEYFPNGISVKEGMEAIAGDKVTYFNGLDAD
GNYSDANMTTAKQYASQADYTVAVIGEPPYAEKTGDLDNLALPAGQIEYVKELASTGTKV
IVVLFEGRPRLLGDLPENVHAVINGLLACELGGKAMAEILYGQVNPSGRMPITYPKDTGN
IMIPYNHRVSTQCADSDDCEMQWDFGTGLSYTEFTYSDFTLSKTNVTSSSDTIDVSVTVK
NSGSMAGKEVVMLFLTQPYRSISVPEVKQLKKFSKISLDAGTSQVVNFTLTADDWSVYYP
QIGNGFKQVAEDTDYVIAIKPETDCDVYNETAAANPLCATFTLQTGDYPYGTFLSSA

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	334	2.6e-56	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.25e-112	86	731	82	742	beta-glucosidase BglX.
224389	BglX	3.91e-58	116	454	59	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.64e-51	132	710	108	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	5.52e-42	37	366	1	314	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	1.15e-41	405	631	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	1.09e-301	1	764	1	763
UIZ29432.1|GH3	8.67e-272	1	769	1	769
UIZ29613.1|GH3	2.96e-271	1	769	46	825
CCA27737.1|GH3	2.66e-268	28	764	67	809
UIZ27116.1|GH3	1.31e-267	45	764	1	725

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.58e-110	26	714	14	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
7EAP_A	6.84e-81	86	717	44	726	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	6.84e-81	86	717	44	726	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
6R5I_A	3.42e-77	100	722	55	705	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.74e-76	100	722	55	705	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	3.60e-116	26	739	77	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.14e-109	26	714	36	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|Q56078|BGLX_SALTY	2.49e-79	100	710	86	725	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	6.12e-76	57	710	35	725	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	1.91e-74	107	746	55	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000240	0.999730	CS pos: 19-20. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in KAG1703193.1.