CAZyme Information: KAG1702258.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1702258.1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	JADEVP010000021|CGC2	52485.05	4.1251

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000021:546844-548337(-)

Full Sequence      

MKIFTPLTIAGLSLAVANGALLTSTYTGAKGLHELATAQGKYMGTATDNGELTDTYYVAA
LQNVSEFGMITPGNAMKWDATESTQNTFTYTKADAIVTLADDMGAKVRCHTLLWHQQVPD
WVQSLSKTEMLSALENHITEVMTHFGDSCYAWDVANEVMGDDATYRKSFWYNTTGTDYIT
TAFKTANSVKKSLGLSTKLYYNDYNTDTVNAKSTAVKDMIQTLLLDKDIGIDGVGFQSHS
SYSDTSTAEDIVTNLERFTALGLDVAFTELDVKTSSTTPSEDEQEKQVTVYTNVVSACQQ
VEDCVGVTIWDFDDTYTWLSNSAPLPWYQPNGKGTALVRKRAYDGIVAGWGTPGSTASSG
TTSTAATTTASASVADEGSFEQETSDADSSSTDTTSFSAGVETTSSLDTEASITSASAST
STTSSSTEAGSTTESPPTGTETSSLAGSTETSGSETAASATESSAATTTTETTTSSSDSS
QTATTGKSGACTRRLRK

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	36	329	3.9e-89	0.933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	5.84e-113	32	348	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	2.20e-95	76	346	1	263	Glycosyl hydrolase family 10.
226217	XynA	3.77e-67	64	330	55	330	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOV63055.1|GH10	6.70e-231	1	360	1	362
AOV63054.1|GH10	5.08e-162	1	360	1	362
AOV63056.1|GH10	2.65e-132	1	350	1	357
AOV63057.1|GH10	2.64e-131	10	350	12	353
UIZ24493.1|GH10	1.27e-118	21	350	25	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	2.26e-90	31	351	2	318	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	3.07e-83	12	351	5	340	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
5XZO_A	1.74e-74	31	347	2	330	Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZO_B Chain B, Beta-xylanase [Bispora sp. MEY-1],5XZU_A Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZU_B Chain B, Beta-xylanase [Bispora sp. MEY-1]
3WUF_A	2.56e-70	32	348	5	310	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	3.60e-70	32	348	5	310	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B7SIW2|XYNC_PHACH	4.45e-76	32	350	84	397	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|Q9HEZ1|XYNA_PHACH	8.07e-76	32	351	94	407	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|O60206|XLNA_AGABI	3.31e-73	21	350	8	331	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|G4MLU0|XYN5_MAGO7	1.30e-68	2	324	3	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|Q8J1Y4|XYN5_MAGGR	1.30e-68	2	324	3	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000389	0.999578	CS pos: 19-20. Pr: 0.9472

TMHMM  Annotations     

There is no transmembrane helices in KAG1702258.1.