CAZyme Information: KAG1701563.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1701563.1
• CAZy Family: GH6
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740		82821.80	7.7756

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000023:553864-556086(+)

Full Sequence      

MSSHPSRRSWLLLAGLYTQLLFGNTLVNAQNDSWDPSGKFPSPTKIVNATTEQSTFCQPR
HLDTMRSKPVPTNAWWGNLVTCDSKTDATNPIWPNPFAISVESSGAYGFALSYPYRNRFF
GGVTDGVAKYYAHPKRNEIQMTAFEFATSIPDMQVTNWTDLGVTVQLQAPASTGTMKSNM
VSGMAYFTSTYQGLTPELLFEAPIATINGASASIGTRYVGSKFNVLAVNGQQWWIHVYPS
VESKSSTIQLNLATSMTLQALTTFNGVIRISSILDATQSTAQDTYSSCIVTGGDVEIASD
SKYSFKWNTEGDCSKGLFHYALDHHTKSLTTASVVEVANVAMYSATRGLMKGFVTVASPP
AWSFYESRKIPVSHYPRTRLTKAVALQQDLFTKLRNDIQSIWTVAKDGSYYFTGKLVQQY
ASLCLMANDPVIVGTDISLLRRCVTKLENAVAPFLDNSWKYKLKYDAVMGGIVSSEGFIT
GDMNADFGNTVYNDHHYHYGYWVHMASVINYLHPTWSRIGELNNMTRLLLRDVANPSRDD
PFFPKFRGFDWFRGHSYSHGMTALGDGKDEESTSEDINFAYSMALFGQNTNHTRMKDIGR
LMTKVTVRSIQTYFLFDSSNKIHPPAYRSHMVPGILFDNKADYATWFSADVYMIHGIQML
PVTPVTEYVRTSTFVQEEWDNILSKLDIVKNDELANSWLSLLYLSYARVNKPQALLKLNQ
CTAMMDGLSRSWALYLAAQS

Enzyme Prediction     

No EC number prediction in KAG1701563.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	66	735	3.2e-168	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	4.98e-155	385	734	5	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.11e-140	59	738	79	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	6.78e-45	67	355	12	300	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20868.1|GH81	8.17e-240	43	738	91	790
UIZ20872.1|GH81	8.17e-240	43	738	91	790
UIZ20875.1|GH81	8.17e-240	43	738	91	790
UIZ20873.1|GH81	6.59e-239	43	738	91	790
CCA25009.1|GH81	5.08e-232	20	738	55	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	3.18e-94	58	738	29	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.41e-94	58	738	54	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.28e-90	58	738	29	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	4.89e-33	70	731	35	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	8.14e-20	477	726	423	663	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.10e-91	69	738	34	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.07e-83	67	738	79	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	3.72e-80	69	734	433	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.86e-77	68	738	459	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q12168|ENG2_YEAST	9.78e-75	24	707	63	741	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000364	0.999600	CS pos: 29-30. Pr: 0.9701

TMHMM  Annotations     

There is no transmembrane helices in KAG1701563.1.