CAZyme Information: KAG1700989.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1700989.1
• CAZy Family: GH53
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	JADEVP010000024|CGC2	37875.02	6.3560

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000024:97670-98756(+)

Full Sequence      

MSSNSNTPLRWGVLGCGRISHTFVSNAKPLKTAIFHACTARSMDRAQEFANAHGIPHVYD
SYEALLSDAEIDVVYIGTIHPTHCELAQLALNHGKHVLVEKPMAMNTKEAEAVITLAKQK
RLFFMEGMWARFFPAVRYVRQLIHEGVVGDVHHVHSAFGVAFKADNDRIWKKELGGGGLL
DIGIYVLATATMVFGYEPEKVTSAGKLNADGVDLYSSVTLEYSGQRFATLEYSTLAKISE
SVTITGTKGRIFIHPPAHATMEISVVTYGDDGKETEKTSRFPWPDPTDHHSGFLYEAEAV
TEAIRNDRIECSEYPHAESLGIMKIMDTIRNDLKLEYAADTP

Enzyme Prediction     

No EC number prediction in KAG1700989.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	9	158	5.6e-20	0.39598997493734334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	3.27e-64	8	330	3	329	Predicted dehydrogenase [General function prediction only].
275173	myo_inos_iolG	4.02e-29	8	309	1	301	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
396129	GFO_IDH_MocA	2.08e-22	9	128	1	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
183212	PRK11579	6.92e-16	9	274	5	256	putative oxidoreductase; Provisional
182305	PRK10206	4.02e-10	57	275	51	254	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO12039.2|GT4	1.06e-13	9	341	2	332
URX63132.1|GH0	6.71e-13	7	264	2	270
BCS38310.1|GH0	6.66e-12	13	217	34	240
BDC49873.1|GH0	6.66e-12	13	217	34	240
CCO12626.2|GH125	1.40e-11	12	191	5	170

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O48_X	2.55e-56	9	340	3	332	Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2O4U_X Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2POQ_X Dimeric Dihydrodiol Dehydrogenase complexed with inhibitor, Isoascorbic acid [Macaca fascicularis],3OHS_X Crystal Structure of Mammalian Dimeric Dihydrodiol Dehydrogenase in complex with Dihydroxyacetone [Macaca fascicularis]
3E9M_A	2.37e-34	9	328	6	314	Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
4HAD_A	2.57e-32	7	259	22	275	Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_B Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_C Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_D Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42]
3EVN_A	1.73e-31	5	253	2	250	CRYSTAL STRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]
3RBV_A	4.47e-27	3	201	23	220	Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP [Actinomadura kijaniata],3RC1_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata incomplex with NADP and TDP-benzene [Actinomadura kijaniata],3RC2_A Crystal Structure of KijD10, a 3-ketoreductase from Actinomadura kijaniata in complex with TDP-benzene and NADP; open conformation [Actinomadura kijaniata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q642M9|DHDH_DANRE	2.44e-69	9	341	3	333	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Danio rerio OX=7955 GN=dhdh PE=2 SV=2
sp|Q6DKE0|DHDH_XENLA	2.39e-65	10	337	4	329	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus laevis OX=8355 GN=dhdh PE=2 SV=1
sp|Q6DF30|DHDH_XENTR	2.66e-64	10	337	4	329	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Xenopus tropicalis OX=8364 GN=dhdh PE=2 SV=1
sp|Q148L6|DHDH_BOVIN	1.01e-58	9	340	3	333	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Bos taurus OX=9913 GN=DHDH PE=2 SV=1
sp|Q9UQ10|DHDH_HUMAN	6.61e-56	9	340	3	332	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Homo sapiens OX=9606 GN=DHDH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG1700989.1.