CAZyme Information: KAG1698492.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1698492.1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		47887.23	9.1216

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000033:513953-515306(+)

Full Sequence      

MERRVVTFAAVTRACVTLLALATSAVVKTYDTSSHLQAGGSPLAVLSNWDGVYFSHIALH
GYDFEHFHAFFPLYPLLARWLAKLIPLEAPVAVLLSGWFISNASFVLAALFLYRLGCVVL
RDEVVARRAAYLFCVAPSSIFMSAIYSESLMCLLSFSGMYLLAKHAQTPDSSRSFSSLVL
CALLFGAASATRSNGILLSLFIAFYRVTVSPSPREFSQFLGFWIRTAFLGLLAIGPQIIY
FVTSMVPYCPTLLKSFGWGVPGARDVEDRSWCTKAVPNLSAMYTFIQSEYWNVGLFRYYE
WKQVPNFLLAAPILVLSLHALQGYFRGNTTPGKATLPHGCGWRGSALTPYYVHWLFLVVN
ALLVVHIQVTTRLLCACPPLFWHPSALMCDSTVKREAPQALTRYGRLVVGYFLLFTVLGS
VLFPSFYPWT

Enzyme Prediction     

No EC number prediction in KAG1698492.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	5	430	2.6e-106	0.9975429975429976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.99e-52	5	430	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.41e-16	46	321	71	316	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	3.45e-237	2	430	6	439
CCA18790.1|GT76	5.07e-121	2	430	6	490
ACO67127.1|GT76	4.10e-62	9	430	9	421
BBN03197.1|GT76	2.53e-54	49	430	84	482
CDS09540.1|GT76	5.01e-53	3	428	5	390

PDB Hits     

KAG1698492.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NUD9|PIGV_HUMAN	7.43e-38	43	430	60	493	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q5KR61|PIGV_RAT	1.92e-37	43	430	60	492	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q290J8|PIGV_DROPS	5.29e-37	43	430	60	452	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1
sp|Q7TPN3|PIGV_MOUSE	9.68e-37	43	430	60	493	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q2GSI6|GPI18_CHAGB	4.87e-36	39	428	71	469	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.628485	0.371520

TMHMM  Annotations     

Start	End
5	27
94	116
129	151
222	244
306	325
345	367
407	429