CAZyme Information: KAG1697981.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1697981.1
• CAZy Family: GH30
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		84840.85	4.5007

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000035:183719-186049(+)

Full Sequence      

MLQSWLAAVCSAAALATAVAAGDAFDAKAQAIVDGFSAEQLLGQMTQLTLSVVMNEDTRE
LNETAVRSFAKQHVGSYLNTYWDKPVNGSYGYNASEFRSIIQRIQEISMEENGGHPIIYG
IDSVHGANYVDGAVLMPQQINSGASFNPDLVYEVARITARDTEAAGISWIFGPILDISQN
SLWARTYETFGEDPYLTSVLGAALVKGLQSYNQSAACIKHFIGYSKTPTGHDRDNVNMPD
FDLYNYFLPPYKAAFEAGALTTMESYTSVNGDPVIASAKILNDLLRTDLGFNGVLLSDWN
EIYNLHDFHRVSATREEAVATSLKQTSIDMSMVAQDSDFIEYGLTMLKENPDQEARLRES
AKRIIKLKLQLGLYDNPVPGEQYVSMVANDKDKETALEMARESIVLLKNEKKALPLPKSA
SVFLTGHSADNVGYQCGGWTFIWQGYGGNEMFKNGISIRKGMENLVGNDSFTYFNGLLVN
GSISDADLAKAVELASQHEYTIAAIGEPNYTEKPGDIDDPALPEGQEKFIEALAATGTKV
IVVLIGGRPRLLGSIPDNAVAIIDGMLPCELGGQAMAEILYGDVNPSGKLPITYPKDAAN
IAIPYNHRVTTRCMWDNCWMQWDFGAGLSYTQFNYSSVTLDKTTIGNADDTLTATVTVTN
TGSRAGKETVMLFLIQPFRKISVPEMKMLKKFKKIELQAGESTDVSFSLSAEDWGVYEPQ
FGKGLKRIVEDSKYVVAVKPDTWCNVYGENITNPLCAEFTIDTTSGAGTVNVGVEL

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	111	332	5.9e-63	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.09e-116	39	742	39	754	beta-glucosidase BglX.
224389	BglX	6.14e-71	113	440	58	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	3.00e-60	130	709	108	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.08e-55	42	367	6	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	1.61e-48	404	630	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	0.0	1	771	1	772
UIZ29613.1|GH3	0.0	1	767	46	824
UIZ29432.1|GH3	0.0	1	767	1	768
CCA27737.1|GH3	5.80e-285	32	761	71	808
UIZ27116.1|GH3	7.32e-282	45	761	1	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	3.29e-125	39	713	27	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5Z87_A	5.43e-87	98	742	106	774	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	5.03e-83	116	742	73	722	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	2.59e-82	116	742	73	722	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	2.65e-82	116	742	74	723	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	7.45e-135	37	738	88	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.44e-124	39	713	49	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|P33363|BGLX_ECOLI	1.84e-88	34	742	35	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	2.56e-88	116	742	105	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	2.90e-85	100	738	50	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.108121	0.891873	CS pos: 21-22. Pr: 0.6443

TMHMM  Annotations     

There is no transmembrane helices in KAG1697981.1.