CAZyme Information: KAG1696870.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1696870.1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		33869.35	4.5377

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000041:290674-291698(+)

Full Sequence      

MSFGRIIITFQVADFSRPRMLAGAALSSLIAFATFASYTEAHGYLEQPKPSWKDGPNVNW
VTLVDNYWDIGSGGDQVGKFKTMAKEKGMSVKDVVLDMVKDQKCGNTLADGPAQPIPSDG
KVKWLGNNGGGFTHTGPCEIYLDDKMVLHGDDCEDEFQGGDVGSKKTSDMTVDFSSCNGK
CLLTIYWLAFQNAQWQTYVNCVPLEGSGGGGASSPTTQGSSTGTGGSGNDDTEQKATDAP
STEQQTPEAPSTGSKPSETSSNEQQAPEASSTGEKAPESPAAETPAATTQATQAPSTPEA
PATEDTKCKAPGRRLRKKLASA

Enzyme Prediction     

No EC number prediction in KAG1696870.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	31	285	7.6e-64	0.9306122448979591

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411474	fibronec_FbpA	7.04e-06	231	302	189	256	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
183854	PRK13042	1.73e-05	233	304	27	93	superantigen-like protein SSL4; Reviewed.
411474	fibronec_FbpA	2.50e-05	230	303	154	248	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
237030	kgd	1.22e-04	230	306	40	116	multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.
166942	tatB	2.08e-04	233	301	72	141	Sec-independent protein translocase subunit TatB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETP52131.1|AA17	2.51e-131	25	322	3	292
ETP24138.1|AA17	5.43e-131	20	319	1	291
ETI54329.1|AA17	1.45e-130	25	322	3	292
ETN14469.1|AA17	1.55e-130	20	322	1	294
ETO83077.1|AA17	2.91e-130	25	322	3	292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	7.76e-30	42	206	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

KAG1696870.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.079436	0.920523	CS pos: 41-42. Pr: 0.8446

TMHMM  Annotations     

There is no transmembrane helices in KAG1696870.1.