CAZyme Information: KAG1696448.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1696448.1
• CAZy Family: GH17|CBM13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1026	JADEVP010000044|CGC3	116404.29	7.0129

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000044:440315-443395(-)

Full Sequence      

MYGNDKQSLMKHEDYELHGTPATGDNDGGAGFYAQEGRPMMQQGYVDPRGPALPPMNVSD
AVGLGSQRDNIISVHGYMHKQGKRTIKGPIHKSWKRRYFALEKAKIYYFHSHLECRQYFT
TRNADLVVGAIELKDALQLRPCARLDLPHKGFEVHTKRRVWVLCPETDDEYRMWFQGVER
AIVANGAGNIIERKLPNVRKYLMKGNQTYRFFYFLFLIAGIVELLAIVFWFVIGLEPCDA
SRLEVDCETITITSLETLRCSAQPFSGWFTPPNWYLKIADVENVQCFRDPPIPQWVSYFA
MLFAEILTFALGVLYYLGMWKPVRRGAHYFDEFEPPVPDELWPKVDVLLCHYSEPAEETI
DTLMACMNLQYPPHLLQIWVCDDGYCKAKWTKGNPVPTVELNKGILETAGDLRQEVAQFM
YDRVCDPNEDMEVYAWRKLHSSANLPSPSRVKVVNRADCAVGSFRDDYRYPGLPHVTFIG
RVKPDVHYSKAGNINNCLYNEGANGRYLIILDTDMQPHPKFILATLPFFFDDEDRQDKAK
YICCGIGCNAVAKLCCASCQIAGVPEEQISYCSKDCFENAMHVQSAVHRRQVNGTMSETR
QSKIDMRCMNCDSKLPKNGVCRKCGNKGADGEDVSSLHTYSDDVKDNAVAFVQTPQYFRD
CIQLQIGDPMGHRNATFYDAIQTGQDGYDCASFAGTNAMFRREALDSIGGIQYGSLTEDC
YTGQVLCSMGWKAQYFRKDFEGEPSERIRLAEGLIPDSVAGSLAQRKRWAKGNFQIALMN
KKTQYFDPEWKLPEAQVPSYHKSNKFMRRVFYFNSTLYPLGSITAILFYYITLYFLYSGY
APIYMAGARLVYALVPKLFVQGVLSALSNRTVENSDVIRSQEVWFAYAFTNCTAVLEAFW
WKITGKEPKWFNTGGASRGSTAELPNVIIFFGTVVGVLWSVVRFLAGYNSIQTSHGASLL
FASLMMGLFIAVKLAPSVRMSIQEYFGWSYESLTDQGNVVGSISIAFGLVFITLWVWIEE
PTSNPF

Enzyme Prediction     

EC	2.4.1.12:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	637	852	5.2e-19	0.8781725888324873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	3.19e-44	343	777	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	3.81e-19	645	845	366	548	cellulose synthase catalytic subunit; Provisional
404513	Glyco_trans_2_3	3.99e-14	630	847	6	191	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133057	CESA_NdvC_like	1.31e-13	645	779	110	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
224136	BcsA	1.15e-12	646	860	165	352	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABP96903.1|GT2|2.4.1.12	0.0	1	1026	1	1026
ABP96911.1|GT2	0.0	1	1026	1	1028
ADD84671.1|GT2	0.0	1	1026	1	1026
ABP96907.1|GT2	0.0	1	1026	1	1026
UIZ24309.1|GT2	0.0	10	1026	1	1019

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.65e-15	644	982	252	577	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.79e-15	644	982	264	589	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.79e-15	644	982	265	590	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	2.95e-14	644	845	378	561	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	5.87e-26	474	776	584	764	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|P19449|BCSA1_KOMXY	5.06e-15	644	776	254	380	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	5.07e-15	644	776	256	382	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	2.60e-14	644	776	254	380	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|Q8X5L7|BCSA_ECO57	1.50e-13	644	845	378	561	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

Start	End
211	233
295	317
810	832
884	903
924	946
956	978
999	1018