CAZyme Information: KAG1696370.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1696370.1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635		67953.98	4.1602

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000044:231065-232972(+)

Full Sequence      

MYGGNSPIGENAGERTHSNVWRDTSEEEMYGSYLGPGANDAGSDVPMMRPTMAARPSTAL
HHDIAVGQLDETVATGGSADKTYTGRKVVWPGALFLLVVTAVALGLIGYFGVEEYNSAQT
QQELTESATEVNRARKSTTVKSCLQPDYVTSDGKIYAKDSNTGEKKQIVFTGINWSGMEN
AEGVPHGLATKQSYLDDIAANLSDNGFNAVRLPLNAQMIIDNSAPNTKLFVNSLDTDLNV
DTYIDMIKKVVQGLGKQQIGVLLDIHKIDPNFTDDTSEHLWYTDDYPIATIYKMFETLAT
ELCSELEYNIIGIDLKNEPVGGCWPEDDTDEYCNSDVNWPRAVETIGDKILAICPNWLIV
AEGNYATNTVAEINGANVTYNDWYGASLQNASVNPIALKTDGKLVFAPHFYSPSVYPSSY
FFKKQSSSGSTVSVTEYPNTTEGNVLLKAAVTAVLDNAFGNAVTEVGVPTFYGEFGGIYG
SAELLEGLTSTRVIEILIEYANDMNMTGGFAWAVNPDGSYDFNDEYKPDDPWQYGLYTDS
TWEKYHKDFATGLQNLKGTGSFPCFSKTTTVTSSSSGSTSATISVDSTTSSSSGATTATT
TTSTAASTAASGSAAAAATTTATTTAPSSATATAV

Enzyme Prediction     

No EC number prediction in KAG1696370.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	165	518	1.2e-143	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.68e-20	148	547	28	396	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.90e-19	182	518	11	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABL75348.1|GH5_20	0.0	1	570	1	572
ABL75347.1|GH5_20	0.0	1	570	1	571
UIZ24458.1|GH5_20	0.0	1	569	1	567
CCA27479.1|GH5_20	4.75e-195	20	567	20	577
CCA26601.1|GH5_20	1.85e-187	20	566	22	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	4.97e-33	148	517	8	349	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	6.77e-33	148	517	8	349	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	2.48e-32	148	517	41	382	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	2.48e-32	148	517	41	382	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	8.33e-32	148	517	41	382	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	3.44e-28	166	517	52	355	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P10474|GUNB_CALSA	4.41e-26	150	422	625	902	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P50400|GUND_CELFI	1.41e-21	166	434	59	329	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000001

TMHMM  Annotations     

Start	End
88	110