CAZyme Information: KAG1696309.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1696309.1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		41927.77	3.7865

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000045:467881-469104(-)

Full Sequence      

MKVLFTVALTATTLATAHAADFCDQWGTATTDNYIIYNNLWGESYATSGSQCTGLDSNSG
STVAWHTNWTWVGASSSVKSYANAALQFDAVQLSSVSSIPSTIEYSLDYSGTIVADVSYD
LFTSSTSDGDNEFEIMIWLAAIGGAGPISSTGSAVATTTIANTEWSLYSGANGDTTVYSF
VASDTVKSFSGDLMDFFTYLIENESFSTSQYLNTVQAGTEPFTGTDVTLTVSSYSAVVNT
GASSGTVTTSSATGSSTTSTSTKELAASSSSTQTDTETTAPVASSSRSYSTEETTTSSTP
TTTTATSVDGEATTSIASSLSGETMTSTTSSQNDKSTTSSTSSTWNEQESNVTSTNSSGA
TTTTMTSSSWAETASPSTTGASTTTASSVGTSTTTGQKCVSRRVRRV

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	91	237	1.1e-42	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	3.48e-48	34	239	3	207	Glycosyl hydrolase family 12.
235746	PRK06215	2.74e-14	23	220	41	218	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB22038.1|GH12	4.26e-146	1	246	1	247
ABB22030.1|GH12	3.57e-141	1	246	1	246
ABB22039.1|GH12	4.33e-105	1	246	1	246
ABB22031.1|GH12	1.71e-99	1	248	1	249
ABB22037.1|GH12	4.35e-98	7	239	5	237

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VLB_B	8.39e-90	20	235	5	218	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	1.06e-89	20	235	12	225	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
4NPR_A	1.64e-81	17	238	22	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
5GM3_A	1.56e-56	20	238	1	218	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]
5GM4_A	1.22e-55	20	238	1	218	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_C Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_D Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_E Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_F Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_G Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BG78|XGEA_EMENI	1.53e-96	7	239	4	239	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|W2PDG1|XLP1_PHYPN	4.19e-96	5	239	4	238	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|A1XP58|XGEA_ASPNG	5.55e-92	1	238	1	240	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger OX=5061 GN=xgeA PE=1 SV=1
sp|A2Q877|XGEA_ASPNC	1.57e-91	1	238	1	240	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xgeA PE=3 SV=1
sp|B8N3L3|XGEA_ASPFN	1.39e-89	5	238	3	239	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xgeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999766	CS pos: 19-20. Pr: 0.9730

TMHMM  Annotations     

There is no transmembrane helices in KAG1696309.1.