CAZyme Information: KAG1695701.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1695701.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	JADEVP010000048|CGC2	34244.89	4.3863

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000048:277553-278515(+)

Full Sequence      

MVFSSAIFGAAALATAYLASPAAAADEPLPWDGRGFDLTVDTLTDKYLTHILTMRNTTDT
KVSDYVTITKDGRSPAYNGDTGVIDIAVDAKAIFKAQTNFRRSELVQNVAANKEGTTFFR
ASVMKEEAFLNPYAWQMIFPESHIFEIRVDATASPPKIIYLNNGTWDAKWETEFVPGTWY
NFGIGVSAAKSGNGSVLEFYTSEGDKDLALEATHDVVTEFPANYEFHYGLLTLSDDGSEP
KMNAKQDIVSYNGVSVEADVVTSATGTGAGASSKAVSTTGSIGAESSDPTTQNETPATQN
ETPATKTGIVKSSDGCARRA

Enzyme Prediction     

No EC number prediction in KAG1695701.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	59	266	1.1e-23	0.8549019607843137

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	2.17e-70	29	262	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26396.1|GH131	1.52e-109	1	274	1	278
CCD28226.1|GH131	3.96e-103	12	264	3	256
UIZ26845.1|GH131	4.31e-99	7	264	343	602
CCA28146.1|GH0	5.03e-22	24	260	17	251
CCA67649.1|CBM1|GH131	6.76e-11	73	268	65	247

PDB Hits     

KAG1695701.1 has no PDB hit.

Swiss-Prot Hits     

KAG1695701.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000316	0.999620	CS pos: 24-25. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in KAG1695701.1.