CAZyme Information: KAG1695257.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1695257.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1658		186550.40	4.9593

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000051:191120-196221(-)

Full Sequence      

MRTWLGAGLALLAAAQPSHVSARGVHVNLTASWPSSPFFPLLETSEFLAEENPLYFWQFL
EQLETRTSYVEFMGGDVDALGALAVTVAESIAPGSKNILELMLATRTYSVKVEMFRQLGL
DSGVRPCGQDADTWAVFYKESRCVESVACSEDELDAILNGKRKNNAQACVASGVNDVELQ
VDHKYPHIESDSEEPTTSAILYGLVGTEKFHGFHAKLVKQAQKNEIQYMVRHYSRDSSLD
TLLQGYGVALDIKNMEYKTIDDSKKAGVEDATGGEEGEEDDEEDEEEVDDEEVEGLLFKP
LITRHSAIDGELKQFYDVLVKKAASEQEQELKAWHLKDLGASAVRAVVDAKDPLKRLETI
SQDFPLQAKKLAFSRKSISTELREEITATRMQATNRRLKNKFIMNGIAVDPTERSFNVFD
FMKTLKEEWSVAKQLDRLPLNQSELEHMLTHVRETNQDQPAARIHMRGAMGGSTPLYLNN
IETDPNSADWSPDINTLRRPAWNLIFLRKNMYECVLVMDPLSGAGRAALSHIGFMRMRGA
PVQWALLVSSKELMASKTSADRQTLVDKYKTFKGTDKATPWHFAKLLMLAQSKDMAESKA
HEEGSKKAESDDEETPESEVEADRIIPTRIASGFLQRVGEDGSSDVLVERLIESYAEAAG
GVGTVEDNEEEAEACLKSDQFDNEVLAMTEFIHLKHIPLNSFVFNGVVQKNLDIQRSMMP
NFGRDQPLYVSMAHRGMLNDDMDLVEELLTEQNAYPAYLSIFDSPEDRSGEVESDLPKHL
FADDVDGRLEAAAQSAISYLHAPGSRSLPKKQTLIFPVNLDDTRDASHAYRVVKAVLEDS
EQSLRVGIAPQLNAKAKSGSVGDLVTAILATIGDSDDGVHLKFVLEALSCIIKQKSVNTM
NDKLRIIWKKTASGTGDKDPVYEKVLALLNSKTGKWLTPKQRTVLTQFNTLLRSRFPPTF
EETEGGTTKIPLPHLFINGRQVTLPPQSLSDEDVMTIVNFDLKYRTQPVAKALIKRSVTL
KTKDADSLSFGVMKTTGVVDKYVRTERTSRMNIDENSQNSIHLPGDSSLQVAAYVDPLSE
AAQVMSSLLRMLHMQLNATIELVLVPADEYSEFPLQRFYRYLFDKKPSLAATSVEFRKLP
VQPILTMKIDTPEAWNVQVFQAGDDLDNLRVDADSPVAVKSITSAVFRLESLLVYGQCRD
TTFNMYSPPNGLQLVLEREVGAQLLHRDTLVMKNLGYFQLQATPGVWSLHLARGRADDLF
DIIDPETELPLETHPITVYDFGSHISQLYVRKKDGMEHEELLQSTEDAASSDKLKSESGK
SSNKDDGALSSYWNSMLNMMGKHDDKKTKSTVADTDQDNSYDENGALTRPKQRTGETIHV
FSVASGYLYERFVKIMMSSVLKRTNNPVTFWLLENFLSPDFKKAIPVLREQFGMDIRLVT
YKWPNWLRQQTEKQRIIWGYKILFLDVLFPLGVQKIIYVDADQVVRADLKELWELDMEGK
PYGYTPFCDSRNVGFQFWRQGYWKDHLRGRPYHISALYVVDLALFRQTAAGDMLRAVYSQ
LSADPNSLANLDQDLPNYAQHQIPIFSLPQEWLWCESWCSDETKAAAKTIDLCNNPKHKE
PKLDMAKRVIAGELFNESWIELDQEIKEAEEAFVAKTA

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1378	1623	2.8e-122	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1378	1648	1	267	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	2.93e-161	1378	1623	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	7.58e-60	1378	1618	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	3.26e-34	35	238	1	182	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	1.49e-26	1196	1303	2	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20865.1|GT24	0.0	1	1658	3	1665
CCA14500.1|GT24	0.0	22	1655	35	1667
AIG56125.1|GT24	0.0	11	1655	14	1507
AIG55512.1|GT24	0.0	21	1653	22	1515
CAA7402965.1|GT24	2.98e-207	23	1651	36	1603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TRT_A	8.92e-142	200	1648	164	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	4.32e-141	200	1648	164	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	5.92e-141	200	1648	164	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	5.38e-137	803	1648	393	1212	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5H18_A	6.78e-116	1378	1648	5	271	Crystal structure of catalytic domain of UGGT (UDP-glucose-bound form) from Thermomyces dupontii [Thermomyces dupontii],5Y7F_A Crystal structure of catalytic domain of UGGT (UDP-bound form) from Thermomyces dupontii [Thermomyces dupontii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0WL80|UGGG_ARATH	4.41e-195	23	1647	31	1566	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q6P5E4|UGGG1_MOUSE	3.14e-191	18	1653	40	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	2.25e-188	9	1653	31	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.74e-186	22	1653	44	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q8T191|UGGG_DICDI	2.63e-179	21	1650	33	1637	Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum OX=44689 GN=ggtA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999759	CS pos: 22-23. Pr: 0.9662

TMHMM  Annotations     

There is no transmembrane helices in KAG1695257.1.