CAZyme Information: KAG1695191.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1695191.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	JADEVP010000052|CGC5	24282.44	8.2466

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000052:311351-311998(+)

Full Sequence      

MTHFGNSCITWDVLSEAVEEDGSYRESFWYKKTGKDYITAAFKTANEVKANLSLQARLYY
NDFNINVINNKSDAVLEMVTDLRSHKHWVEGIGFQSHYTNNDSVAGAKIFDNFRRFTIKH
MDVAVTELDVKTSTAKPTVREQQQQVGIITNVVSACKRVMRCVGVTVWDFVDTYSTINSS
APLLFYQPDGPRTPLIRKATYDAVTSGWILSGGKK

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	1	187	1.8e-44	0.5841584158415841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	7.30e-51	1	204	112	308	Glycosyl hydrolase family 10.
214750	Glyco_10	7.63e-47	1	204	70	263	Glycosyl hydrolase family 10.
226217	XynA	4.25e-34	1	188	135	330	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOV63056.1|GH10	3.71e-130	1	210	150	359
AOV63057.1|GH10	1.77e-127	1	209	146	354
UIZ28775.1|GH10	1.34e-105	1	210	147	356
UIZ24493.1|GH10	8.58e-94	1	211	147	355
AOV63055.1|GH10	1.66e-74	1	208	142	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XZO_A	3.11e-48	1	202	120	327	Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZO_B Chain B, Beta-xylanase [Bispora sp. MEY-1],5XZU_A Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZU_B Chain B, Beta-xylanase [Bispora sp. MEY-1]
3WUB_A	9.85e-37	3	182	115	287	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUF_A	9.85e-37	3	182	115	287	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
4F8X_A	2.49e-34	3	180	120	300	Penicillium canescens endo-1,4-beta-xylanase XylE [Penicillium canescens]
4XX6_A	5.19e-34	1	182	118	294	Crystal structure of a glycosylated endo-beta-1,4-xylanase (glycoside hydrolase family 10/GH10) enzyme from Gloeophyllum trabeum [Gloeophyllum trabeum ATCC 11539],4XX6_B Crystal structure of a glycosylated endo-beta-1,4-xylanase (glycoside hydrolase family 10/GH10) enzyme from Gloeophyllum trabeum [Gloeophyllum trabeum ATCC 11539]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B4XVN1|XYNA_STRSQ	6.81e-35	3	182	153	325	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
sp|O60206|XLNA_AGABI	7.01e-32	1	208	132	331	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|G4MLU0|XYN5_MAGO7	1.19e-30	3	182	153	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|Q8J1Y4|XYN5_MAGGR	1.19e-30	3	182	153	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1
sp|Q5ZNB1|XYND_TALFU	3.31e-29	1	177	133	304	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000004

TMHMM  Annotations     

There is no transmembrane helices in KAG1695191.1.