CAZyme Information: KAG1695167.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1695167.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1070		117987.56	4.9028

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000052:221576-224788(+)

Full Sequence      

MIGIRIALLVLWSCFLCAAGIDLKLQLPFPVESHPLQLSTSLFAASERLPLDAHVGNSTH
GERPKLLADVPFPTGAWWTNLVLAEGQSAVVSMPYVHKILGEKLHVSFPFRVVAPRVIQS
GFIAQMVVSSEAVQTSTLPLAHHVVNFDAFSTTVRFSRGQAEEFRVYLVRGSPYITMEYT
HSRPLLEAKDGMLIKRFKKLQGLTLMSGDDVSFATFAVELNNGQTWYIYASDKDLQLKLN
DNGQVTSDKAFTGVLRVALCHDAKVMPYLLDSAPVYAVGGDVAYSVDPKDSDKALLDFQW
KTKSFASFHDEKTQVTEEENNKLLMLALPHHMDVMQVQTDNKPVQKGKNKVLSDLRFTSI
RGLMEGVFGAVWHMKEELPTVEWNYADDGLFSDDFDDDLDDKQRRLDMRAKVTEAIVKEL
PVDANKYPPPMSPDSYNFGKQVSRDARLLLIADKFKQEEVKQTLLTKVKEEIADWLEGTN
VDHFVYDQTFGGLITNDGWHDDQADYGNGYYNDHHFHYGYFAYALAAIRKFDPEFIERHA
QVCALILGDIGTPLLNSNTSFFNDLPVRLLFPTARHKDWFVGHSYASGLFPMEDGKSQES
SSEDLNAYYSLALFSSLDEEPKGANSYHQYARLLLATELRSVKKYWHMSENSNIYEPSFS
KNAMVGVVGEISVVYNTWFGDRAVYIHGINMLPFTPFTPQLLDEKYVAREYALLSQDLPD
LSPYDIWRSIVVMDHAILDGAEAWDELNNTVKAFDTWSSRTNAMYWVATRPSWFAQKNRA
VLSHPDLDADDKCFGFPACATAGENGTALMCCGTLPGCCPSALGCCPQEDPALLPSNACF
GEHECAVLGLGCCNTIDGCCEPDPITGAVLGCCKNQHPVIKNTTHKAVTKAKDPSVCYGE
PLCDAAKLDCCGSPGGCCSDSGVQLDCCSSEKPTTAVSNKSHSSDSNSCQGQPKCGAAGL
DCCGWDGGCCKPDPTTGAKLDCCEDEPSSNGHHDDEDDSEDSSTSSTGSSITRIFIGLGG
AILLVAIVYTVGLCYRRRGYASIDGDMRSLYCAGLMVGVIAFFIFLIVTS

Enzyme Prediction     

No EC number prediction in KAG1695167.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	69	766	9.3e-160	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.26e-80	410	761	4	346	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.25e-76	52	745	66	727	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.89e-51	69	386	12	317	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29064.1|GH81	0.0	8	1070	8	1080
CCA18874.1|GH81	9.99e-230	60	1065	15	921
AUX36386.1|GH81	3.30e-103	71	771	90	713
AGP40408.1|GH81	4.82e-103	71	771	79	702
CAN97272.1|GH81	1.00e-102	50	771	68	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	5.71e-49	144	783	131	731	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	7.21e-49	144	783	156	756	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.35e-48	144	783	131	731	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	5.88e-29	357	772	281	658	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	9.33e-23	348	767	295	689	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	5.45e-42	216	745	183	674	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	7.21e-39	123	744	298	873	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.09e-35	131	745	184	750	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.78e-34	69	764	431	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	8.07e-34	130	750	153	714	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000664	0.999306	CS pos: 20-21. Pr: 0.9205

TMHMM  Annotations     

Start	End
1014	1036
1049	1068