CAZyme Information: KAG1695100.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1695100.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240	JADEVP010000052|CGC6	25725.50	4.3695

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000052:44822-45544(+)

Full Sequence      

MKFSTIFAAAAVTASSVSAETFCGEQNKTETADYILYNNLWGAYDDPKGHQCTSLDSVDG
SSISWSTNFSWNGTAWQVKSFANAALKFDHVPIANVTSIPSTIEFDFAYEGKLVANVAFD
MFTASKLGGDAEYEVMVWLQAIGGAGPLSNTGKPIKEVNVGGVDFSLYHGKNGNMTVFSY
VAANTANNFSTDFKQFFDELPANNSIASEQYLVNVQAGTEPFVGNGTLTVSKYTAAVHTA

Enzyme Prediction     

EC	3.2.1.151:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	92	237	5.5e-36	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	2.70e-39	34	237	3	206	Glycosyl hydrolase family 12.
235746	PRK06215	1.18e-08	34	194	52	193	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB22026.1|GH12	2.29e-137	1	240	1	243
ABB22034.1|GH12	1.37e-114	1	240	1	242
ABB22027.1|GH12	1.68e-110	1	240	1	243
ABB22025.1|GH12	4.91e-108	7	240	9	243
ABG91065.1|GH12	9.39e-106	1	238	1	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NPR_A	1.39e-69	18	237	23	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VLB_B	9.68e-60	22	237	7	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	1.20e-59	22	237	14	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
6K9D_A	9.77e-42	20	238	1	218	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
6K98_A	5.63e-41	19	238	1	219	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BG78|XGEA_EMENI	4.18e-72	1	237	1	238	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|W2PDG1|XLP1_PHYPN	6.58e-71	17	238	16	238	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|B0XNQ1|XGEA_ASPFC	3.76e-70	1	237	1	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xgeA PE=3 SV=1
sp|Q4WJU8|XGEA_ASPFU	1.07e-69	1	237	1	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xgeA PE=3 SV=1
sp|A1D4F1|XGEA_NEOFI	1.07e-69	1	237	1	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xgeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000227	0.999735	CS pos: 19-20. Pr: 0.9719

TMHMM  Annotations     

There is no transmembrane helices in KAG1695100.1.