CAZyme Information: KAG1694331.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1694331.1
• CAZy Family: GH131
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	JADEVP010000057|CGC2	58395.65	4.3667

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000057:331668-333260(+)

Full Sequence      

MKIQAAVTGLLSLAGLATAADPSWKNLAISAPRYGRYLTRTASNDPFFWQADTAWELTHK
LNKTSIDLYLKTRAEQGFNVIQTVVIAELNGTTRANFYGDLPYNNSDTTQPNDAYFQLID
WTVDLAASYGLLVALVPAWGRWINGGWHGDETSIFNESTAYEWGKYLGERYPGLPKILGG
DSDCLWPRNTSAAMVSYATDPNVDPATLLGPIENTTDIWTSMYSGVEDAETAQGYEPVIL
FHPTAGWISRPENTPEAYAHWMLPTEEYRVSINGAQSGHAVPAALGGFTPYTTWDSTKNY
NLIATMRDSFTGPVLDLENHYEGAHYNFRSTFPIWNASEVRTGLYAGVYGGAAGFTYGAN
SVWQMYEPAADLLRESDYYSPAASQNASGSWREDILFEGATQIQYVTKPLQGFSTEALEQ
LEPGRQFLGSPSGYLDTAVNAFEGTRYISVLASEARDRYFVYTGHGDSFSLKLGIGAERL
GEARWFSPRDGLYYANSTITVPATGNGTRVDFTPPSSGGVDNDWLLVLEF

Enzyme Prediction     

No EC number prediction in KAG1694331.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	35	500	1.5e-75	0.9393203883495146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	6.22e-112	35	413	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	9.86e-13	444	529	12	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	4.23e-159	24	529	28	534
KAF3763706.1|GH140	1.83e-149	14	528	17	535
KAE8313632.1|GH140	2.94e-75	10	529	7	508
KAB8203844.1|GH140	1.14e-74	28	529	28	508
KAB8276359.1|GH140	4.39e-74	8	529	5	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.68e-23	24	491	13	413	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	5.75e-22	24	491	13	413	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

KAG1694331.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000932	0.999035	CS pos: 19-20. Pr: 0.9772

TMHMM  Annotations     

There is no transmembrane helices in KAG1694331.1.