CAZyme Information: KAG1693601.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1693601.1
• CAZy Family: GH12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	JADEVP010000063|CGC3	44459.61	7.6645

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000063:198451-199671(+)

Full Sequence      

MSEAFSRRFLRWQLALMNGSRRPSVHEGFAALALILTLVVLYSQREAVITSSLHPVTPFQ
APLNEQVKFSSVLTENASVSVRDDTFPQYGDKSKPGRHWRVENSYLLSHPSYKNENSVLL
MVVLKDEASWGEGRSAADFFELLSSFDYPKEKMSVTVLTSSMREFNVVQNHFQKQIRWYS
RLSVLFRDDFSPEDVVTRENRHEHAVQLNRRRVIARYRNFAVLSTLELWHQHVVWLDADV
HRVPATLLKKMVTSGRDIVEPMCVRMKESGEDWYEYDLNAWVGQRKVRRSSRDTSFVPGD
LSVKRLKQFHGGPDTFVPLDSVGGTMLYMKADVHRQGVLFPLHHVIGSEWESEGYDGIET
EGICYVAHFLGFKCWGMPNDLIYHI

Enzyme Prediction     

No EC number prediction in KAG1693601.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	110	342	2.6e-41	0.9253731343283582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.33e-43	113	341	18	262	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.
224137	GT2	0.004	191	384	46	219	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR43931.1|GT62	4.16e-50	80	384	141	468
CCE80338.1|GT62	3.49e-48	91	384	59	382
CCE81103.1|GT62	3.49e-48	91	384	59	382
QFZ40297.1|GT62	2.47e-45	111	385	96	392
QFZ51639.1|GT62	2.47e-45	111	385	96	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	2.70e-18	139	385	40	300	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O36022|MNN9_SCHPO	1.33e-24	103	384	53	334	Mannan polymerase complex subunit mnn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnn9 PE=3 SV=1
sp|O74745|ANP1_SCHPO	1.48e-21	134	385	107	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P53697|MNN9_CANAL	2.04e-21	179	384	155	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1
sp|P39107|MNN9_YEAST	7.51e-18	139	385	130	390	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3
sp|Q00314|VAN1_CANAX	8.01e-17	147	385	179	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000049

TMHMM  Annotations     

There is no transmembrane helices in KAG1693601.1.