CAZyme Information: KAG1693136.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1693136.1
• CAZy Family: GH10
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925		99481.16	4.5695

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000066:291066-293843(+)

Full Sequence      

MQSCAWLRAALVTTVATQVSAEFGGLLASGSYKEGTVHAADQAQEPISTGDYLSPFATDA
PSEALFQRKDGLAALAPIINVASDLLDKPIPTNKWWGNLIHTTAEDINTVANPAWSNPYA
LKLPKEAPFGIQACYSYTYRQMSHEAADIVKYYLHEFHNDITLSASEFGSTKPDYEVYAF
SELGVSVRTCVSGSSNCMDSALVHGMAFVSATYSGLTPRLESEYAMTLLDNTTPGKYIVE
LANKQTWVVFTSDTSASFFIDGTGSALVASEVYTGTVRVALLTESGDQSVYDDYATCVVR
GGDVSVQSRTSYSLNWETEGSGCDTKGLLQFALPHQVEVMSGATTAQSKGSIVLHSSTRG
DMVGQVTETGTWTLSESEADEEVDFYPASKPSAEVVSQVNLLSTLKNDIDSEWALNTGSW
YYNGKAYQKYASLCLMAADSSVVGDDTTLLRTCLTKLEALIVPFVNNSMSVPLVYETSYK
GIVTSQVFATNDVNVEFGNGVYNDHHYHYGYWVTASAILKKLDPSWSGMAQLENMVWTLL
RDVANPSSDDTYFPKFRHFSWFLGHSYSHGVTPMADGKDEESTSEDVNFFYGMMLWGKVT
GKKAVEDLGSLMLRLNARTVRTYFLMTSDNTIHPPQFVPNHVTGIFFDNKADYATWFSAE
KYCIHGIQMIPVSPINGLVRTKTFVQEEWDDILSKEAIVTGVDTTNAWLSLLLVNEAAIN
QADALAKLATVKMDDGLTRSWALYNAATRGGPDSSTSTKVVTIAPSTTTAAPSPTSETPV
VTTATPSVTTAAPTVTTATPTTTTKSPTKAPVATTSTPTTSPISQTEVVATTSTPTTSPI
SQTEVVATVTPARPSTPVPSAATSTPSSTPPPSPVTSPPDTSTGTNYPGWTSIPPGWTSI
PPGWTSIPPGWTSYTPGVVVPAKQS

Enzyme Prediction     

No EC number prediction in KAG1693136.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	81	744	2.5e-174	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.89e-146	405	743	18	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	3.54e-132	77	752	78	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.02e-49	87	389	12	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	0.0	11	768	6	759
UIZ26440.1|GH81	0.0	11	768	6	759
UIZ26131.1|GH81	4.74e-305	52	757	12	723
UIZ26137.1|GH81	3.81e-302	52	757	122	833
UIZ26602.1|GH81	3.81e-302	52	757	122	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	5.98e-101	88	749	39	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.06e-100	88	749	64	743	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.17e-96	88	749	39	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	3.38e-25	503	693	414	603	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	8.67e-22	503	737	439	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.28e-99	51	751	2	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.76e-90	89	747	225	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.28e-86	49	747	425	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.47e-85	81	747	73	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	2.56e-80	77	720	99	744	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002548	0.997438	CS pos: 21-22. Pr: 0.9548

TMHMM  Annotations     

There is no transmembrane helices in KAG1693136.1.