CAZyme Information: KAG1692738.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1692738.1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
874		97332.83	6.3443

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000070:276206-278965(+)

Full Sequence      

MEAIATLVTLCVGLGYWFYLRPGRTYVPSPSNSTTTGPARSREERFAAFVENEVSANGIV
LFIASGGCLEPFQALFAALQAQLHVVDLTKTAGGSKVLEALHDKYQTQDKQHEFLFVKGK
LVGDLAQLRKLLADGRKDELGADCDWSQVRVDPKSDTGFMVLDAANGFQHVQDTGDTEEI
PKLEARPLYTVEELRNFDMTKLIGCSVPIAQRARKQRRRSKLLVCHDMKGGYQEDRFKQG
CDDFDAYRFYQWDLVDLFVYFGHALVCPPPTGWIAAGHRHGTRVLGTFLTEGEQGTDLCK
DLFQDAHSAEAFASKLAAIAWHGGFDGWLINIENDIAAGLVANFDVFLRTLRKGMQLRNQ
LAQVVWYGSLARSGKRSSFVRLNEASTDFFRNVDAFYTDYGWAPDDAKFSAAFDLDRRYD
IYMGIDVFGRHNMLGGGKMNCSEPLRVAWNSGVSAALFAPGWTHECYQHEEQSDFVVVEN
RFWNAVRESWKAKSPCYDALGGKNCLYSAFNIGRGIGVWTDGKRVGAAAWSNMTELDVQP
DQALHVGNVITTATGSMKAVISHDTAFQGGSSVQLQGQLVGREKSYFKLYDVDIEFSPRR
IMEISYTTATREESVCLLVLTICPGIDRATHYVILRSMDDSGPDSGDNRLDSKKTLSTVA
MASLEKHFYLPVSTEFFTVEGVHPEAVQGITGDGWCKKTYRLGGQLWDQKHIVEIGVLCT
KKIRKVPGEREDYLAFIGELCIVGRSGKPAVKAVHRDVHSQPKVCENAKITSFKRHDAES
VAFEVQWDFSSDGAPVRYVLAFAHTEDSERVFIGKSFDNVLWVDQFSWCRNQGATSTSSH
SSTRLTIELQSVSWTGQSSTGVCQLHLEESNVEG

Enzyme Prediction     

EC	3.2.1.96:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	228	496	2.3e-66	0.8761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397623	Glyco_hydro_85	2.42e-99	240	515	1	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
119364	GH85_ENGase	1.62e-89	223	540	1	329	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
227068	COG4724	9.95e-31	239	608	94	479	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHN91514.1|GH85	6.48e-78	206	627	45	453
QHO27239.1|GH85	1.15e-75	206	627	45	452
VDC85346.1|GH85	6.84e-75	206	620	52	454
VDC78376.1|GH85	1.25e-74	219	620	65	454
CAG7878887.1|GH85	1.70e-74	219	620	80	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FHA_A	2.41e-22	239	597	71	441	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	2.41e-22	239	597	71	441	Chain A, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	5.68e-22	239	597	76	446	X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
2W91_A	5.51e-17	234	606	70	458	Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	7.60e-17	234	606	221	609	Crystal structure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F4JZC2|ENAS1_ARATH	1.54e-73	206	634	49	466	Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGASE1 PE=1 SV=1
sp|Q9SRL4|ENAS2_ARATH	7.53e-71	206	614	54	471	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1
sp|P0C7A1|ENASE_CHICK	6.02e-66	205	589	105	474	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1
sp|Q8BX80|ENASE_MOUSE	5.44e-64	219	606	114	491	Cytosolic endo-beta-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Engase PE=1 SV=1
sp|Q8NFI3|ENASE_HUMAN	5.30e-60	219	577	122	469	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.990963	0.009058

TMHMM  Annotations     

There is no transmembrane helices in KAG1692738.1.