CAZyme Information: KAG1691369.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1691369.1
• CAZy Family: CBM47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249	JADEVP010000084|CGC3	27115.08	4.4314

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000084:168865-169614(+)

Full Sequence      

MKFAGVLASVGLLGVAAAGYGEVQQSTPDVTPAATTAAPTTTSFARFFDQERFHDMFPDA
VELYNFDGLVNAANKYTTFANTGNDTNDKRELAAFLAQTAHESDNFKAPEEYARNTYTVW
QYCDNTTYPCAPGKRYHGRGPIQLSWNYNYFNAGEALGIDLLNNPDIVANDTAVTWMTAL
WYWMTPQGGRVIHDVVAGVNGFAESTDIINGALECGGPNQANEKPRIAYFTKMCAALDVQ
PLGNTSCNA

Enzyme Prediction     

EC	3.2.1.14:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	45	247	7.2e-66	0.974025974025974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	2.55e-76	48	247	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	3.24e-57	64	247	25	232	Chitinase class I.
225720	COG3179	2.04e-08	50	213	6	187	Predicted chitinase [General function prediction only].
381610	chitinase-like	2.24e-04	94	210	1	105	chitinase-like domain. This family includes proteins such as chitinases, chitosanase, pesticin, and endolysin, which are involved in the degradation of 1,4-N-acetyl D-glucosamine linkages in chitin polymers and related activities. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Chitosanase enzymes hydrolyze chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Pesticin (Pst) is a anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22871.1|GH19	1.05e-133	1	249	1	256
CCD28125.1|GH19	2.40e-131	43	249	52	260
AAN31509.1|GH19	2.64e-131	1	249	1	234
BAY91283.1|CBM50|GH19	5.15e-60	39	247	154	361
ABX04815.1|CBM12|GH19	5.94e-59	36	247	222	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CJL_A	5.10e-55	50	247	5	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
3WH1_A	4.49e-51	43	247	3	206	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
7V92_A	7.09e-51	48	247	11	236	Chain A, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]
7V91_A	7.09e-51	48	247	11	236	Chain A, GH19 Chitinase [Ficus microcarpa],7V91_B Chain B, GH19 Chitinase [Ficus microcarpa],7V91_C Chain C, GH19 Chitinase [Ficus microcarpa],7V91_D Chain D, GH19 Chitinase [Ficus microcarpa]
4IJ4_A	2.46e-50	43	247	2	205	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q41596|CHI1_THECC	5.18e-50	48	247	81	306	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
sp|P86473|CHIT_ACTCC	4.60e-48	64	247	100	307	Endochitinase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc04863 PE=1 SV=2
sp|P52405|CHI3_SOLTU	5.86e-48	64	247	96	303	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1
sp|Q39799|CHI1_GOSHI	6.81e-48	64	247	101	309	Endochitinase 1 OS=Gossypium hirsutum OX=3635 PE=3 SV=1
sp|Q39785|CHI2_GOSHI	7.72e-48	64	247	79	287	Endochitinase 2 (Fragment) OS=Gossypium hirsutum OX=3635 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000657	0.999331	CS pos: 18-19. Pr: 0.9374

TMHMM  Annotations     

There is no transmembrane helices in KAG1691369.1.