CAZyme Information: KAG1690612.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1690612.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750		81773.43	4.1179

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000092:144395-146647(+)

Full Sequence      

MLSQSGQRWQTLRLLSGESVTFEAVGFEASIEVIDDLSTLPGKFSCSNDKYNKIWELGAR
AVSAACVDAGSQVSSWSSSKENGTFVPGSRPGVSYKTWNLSDYILEFETQIIRGGVGFYV
GYDVSGNRGSLMFHVSSEYPADSTYVNINSTLFPANTASLVYGFDFVNSSSMTSYPLGSY
SVPFKVKENVWYPVKLAVNSTAGDLVLWLDEQQVLNATISEFGYSETQLSSQGYSTTGKG
AIGFGGWQDQASFVRNVTATSLNSLETLYSNSMTDENLVLPEFGVQSNTYGACLDGAKRD
RYIWLGDFYHTTRIMGVANSKPEQIAGTWQYLLSYQAPNGQYPGLMTMTYETPMPTPEIF
MFDAGTDNAYFNFPDYDILGLIGFVSYMEYYDDVAFAKANWESFNKTVNWLLSCQGTDGL
IDVTKYLVVFLGSGRGTAVNAAAVQCLEGMAKVAQAVGDEDSASQWVEAAGTIKTAINEL
LWNDTLGNYAVDASAPEVYGVSATAFVITSGVANETQIELCLKGLENLRQGPGYLDASAT
NKTSQISPNTNGFLLDALLQTGHTDEAAFLLDNLWDAMISNEKYRSGASWEYVAQSLEPG
LAEYTSLSHPWGGAPTYALTNYVAGIRPVEFGFRRWILNPLVTGLEITRANATVSTPYGE
LSAGWDFISNDTLTVTITAPAGTEGVLEMMQLNATIYKQNINGTGESISFTVQLLLTDIL
SIGNLSVIYFRFYLGFSVLSTFGNLSVIYF

Enzyme Prediction     

No EC number prediction in KAG1690612.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	284	688	3.9e-64	0.7420634920634921

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	3.08e-11	249	623	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	1.19e-08	625	687	1	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC81232.1|GH78	6.39e-168	2	685	109	800
CCD52401.1|GH78	6.37e-165	2	689	127	812
ATZ56607.1|GH78	3.55e-164	2	689	151	836
QMW40986.1|GH78	2.35e-157	2	685	128	804
QMW28911.1|GH78	2.35e-157	2	685	128	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.02e-07	294	682	331	690	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	1.02e-06	295	622	237	541	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

KAG1690612.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

Start	End
727	749