CAZyme Information: KAG1690457.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1690457.1
• CAZy Family: AA6
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815	JADEVP010000094|CGC1	91522.15	5.6694

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000094:177103-179765(-)

Full Sequence      

MIDEDTMSEYEAMLPVDAPQAAPKTRRRLQRMDVALLVVILLVASYVGVRPPAMRTANPL
LLSSDDTKSYQYLTYDAIDAAKRQSGYSVSYSSRGFEIDGKQTLLLGGSIHYPRSTPGQW
EQLLREAKRDGLNHVEMYVFWNVHEQERGVFNFAGNANITRFYELAAEVGMFLHVRFGPY
VCAEWSNGGLPVWLNWIPNMKVRSSNAPWQSEMQRFVRYMVELSRPFLAKNGGPIVMAQI
ENEFGGHDPEYVEWCGNLVKELDTSIPWVMCHANAAENTILSCNANDCVDFAVKQVQERP
SDPLVWTEDEGWFQTWQKDKKDPPSNDQRTPEDVAYAVARWFAVGGAAHNYYMYHGGNNY
GRAASAGVTTMYANGVNLHSDGLSNEPKRSHLRKLHEALIACNDILLRSDRQALNPHDLP
ILDKQTLETSSQQRAFIYGPEGDEQVVFLENMASERVTVVFAGTKYKLAASSMLILKAGV
LLFDTADVSKSFPGHQRRLYTPIVKATALEWEIWSELNVSSSIPKRRVIADYPIEQLRVT
EDRSDYMTYETTFSLSGSNSHASTVKVTSCEGSSIVAFVDDYLIGERSLGYPGDNCSKEF
SFHLPANFDVDLEHHLKLVSVSLGIHSLGSNHSKGVTGDIRIGHNNLAHGQQWEMYPSLL
GEQLGIYYPQWISSVPWTPVPRTSEASARGGRQLMSWFATSFQYPAELMKATEHQTSILL
DCIGLTRGRLYINGHDLGRYWLVNDEGEFVQRYYHVPYDWLVKDRENLLVVFDELGGSIF
NVQLVSSTMKLEAIGAGESPTTASTNESSVIAVGR

Enzyme Prediction     

No EC number prediction in KAG1690457.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	96	397	4.1e-89	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
166698	PLN03059	4.41e-119	88	789	29	728	beta-galactosidase; Provisional
396048	Glyco_hydro_35	1.57e-95	96	396	2	315	Glycosyl hydrolases family 35.
224786	GanA	2.81e-23	89	423	1	369	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
396834	Glyco_hydro_42	3.51e-07	111	255	6	150	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26848.1|GH35	0.0	1	789	1	795
CCA17560.1|GH35	1.66e-242	31	790	40	795
ACD54699.1|GH35	2.24e-157	73	778	22	721
UJR36785.1|GH35	8.84e-157	73	788	22	735
ACD54708.1|GH35	6.00e-154	73	778	22	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5F_A	1.06e-103	84	785	3	703	Chain A, Beta-galactosidase [Solanum lycopersicum],3W5F_B Chain B, Beta-galactosidase [Solanum lycopersicum],3W5G_A Chain A, Beta-galactosidase [Solanum lycopersicum],3W5G_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK5_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK5_B Chain B, Beta-galactosidase [Solanum lycopersicum]
6IK6_A	7.90e-103	84	785	3	703	Chain A, Beta-galactosidase [Solanum lycopersicum],6IK6_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK7_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK7_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK8_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK8_B Chain B, Beta-galactosidase [Solanum lycopersicum]
4MAD_A	2.61e-45	96	386	24	321	Chain A, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	2.66e-37	96	361	10	284	Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
6EON_A	7.43e-37	86	395	17	345	Galactanase BT0290 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9MAJ7|BGAL5_ARATH	4.20e-109	88	789	30	731	Beta-galactosidase 5 OS=Arabidopsis thaliana OX=3702 GN=BGAL5 PE=2 SV=1
sp|A2X2H7|BGAL4_ORYSI	2.40e-105	88	788	37	728	Beta-galactosidase 4 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_006270 PE=3 SV=1
sp|Q6Z6K4|BGAL4_ORYSJ	4.70e-105	88	788	37	728	Beta-galactosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0219200 PE=2 SV=1
sp|Q9SCV9|BGAL3_ARATH	6.20e-105	89	789	33	733	Beta-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=BGAL3 PE=2 SV=1
sp|Q9SCV4|BGAL8_ARATH	1.58e-103	88	777	31	725	Beta-galactosidase 8 OS=Arabidopsis thaliana OX=3702 GN=BGAL8 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000016

TMHMM  Annotations     

Start	End
34	53