CAZyme Information: KAG1689479.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1689479.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215		21803.79	5.5973

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000106:28850-29497(-)

Full Sequence      

MKLSTTILGSILLLLTSPSNLVNAECSDVHVVFARGSGEMQGLGICGEPLVSGITSDLSG
MSVSSYAVSYLASMDQTSAGPGATDMTNHVVSVAQECPNTVFVLGGYSQGASVTDIAIGI
KTTLGSGQTIPDTLAARIKAVVTFGNPLKLMGQTIESSSSTYGPKAIEFCNTGDPVCGNG
FNTMAHLTYATDGSVTTAAQKAAALVKGSARALRA

Enzyme Prediction     

No EC number prediction in KAG1689479.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	25	201	7.7e-52	0.9682539682539683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.90e-42	26	208	2	171	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY60079.1|CE5	3.62e-118	1	215	1	215
AAY43367.1|CE5	2.70e-113	1	208	1	208
AAO92431.1|CE5	3.25e-109	1	213	1	216
AAO92430.1|CE5	3.25e-109	1	213	1	216
AAX55266.1|CE5	8.36e-106	5	214	8	216

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	3.81e-16	23	198	76	241	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
2CZQ_A	1.17e-11	23	201	3	195	A novel cutinase-like protein from Cryptococcus sp. [Cryptococcus sp. S-2],2CZQ_B A novel cutinase-like protein from Cryptococcus sp. [Cryptococcus sp. S-2]
4OYY_A	6.89e-11	26	189	17	176	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
1CUX_A	1.24e-10	16	192	18	194	Chain A, CUTINASE [Fusarium vanettenii]
1BS9_A	1.57e-10	25	192	1	193	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6WFI5|CUTI_KINRD	3.75e-63	24	209	34	221	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1
sp|P9WP39|CULP3_MYCTU	1.22e-35	26	212	44	228	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1
sp|P0A537|CULP3_MYCBO	1.22e-35	26	212	44	228	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP38|CULP3_MYCTO	1.33e-34	26	182	44	204	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1
sp|O06319|CULP4_MYCTU	1.85e-32	23	189	44	210	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999772	CS pos: 24-25. Pr: 0.9773

TMHMM  Annotations     

There is no transmembrane helices in KAG1689479.1.