CAZyme Information: KAG1689463.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1689463.1
• CAZy Family: AA2|AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185		21080.49	8.1220

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000107:200291-200848(+)

Full Sequence      

MARSHNFDYYWYVAFDSKWRVTNGGKEVEADFGIFKEDDTMKSNFQGLTIGWKDPKALRN
AGTKLLLSKKDGNVYMSSKSADWLVQEQQVWFFDSATQQVRSKSSDRCLDAYQGWNGGIV
HVYRCMDNEVNQKSTFESSTGKLKHAKHQGFCLDTDPAQGNKLQLYGCSPNNPNQQWSVI
NPANI

Enzyme Prediction     

No EC number prediction in KAG1689463.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	57	182	2.9e-16	0.6808510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	1.11e-15	86	177	35	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	7.64e-10	89	177	36	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	2.22e-09	99	179	4	84	Ricin-type beta-trefoil lectin domain.
238092	RICIN	3.02e-09	104	181	8	84	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	5.01e-08	102	181	3	78	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBC18032.1|CBM13|GH17	1.68e-112	1	185	259	443
QBC18038.1|CBM13|GH17	1.68e-112	1	185	259	443
QBC18040.1|CBM13|GH17	1.68e-112	1	185	259	443
QBC18039.1|CBM13|GH17	1.68e-112	1	185	259	443
QBC18034.1|CBM13|GH17	1.68e-112	1	185	259	443

PDB Hits     

KAG1689463.1 has no PDB hit.

Swiss-Prot Hits     

KAG1689463.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAG1689463.1.