CAZyme Information: KAG1689379.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1689379.1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221	JADEVP010000108|CGC1	25667.01	6.2239

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000108:148881-149546(-)

Full Sequence      

MHTRQVRVNLVHKLQDEYHVRTIGVDSIRADATERTWKESLTKLRVFQDWGYDRVVFLDA
DAVPMVNLDHLFDLPPATLYAPTAYWLEQPFFASTLLVVEPSEAVFNDILQWARDHGADA
GFDMDILNKYFKDSVQYLPGTYTVLNSDFRRAPSDKSTLFNTTAELKEHAKVVHFSCKPD
GSYGKPWNWPTHDLSLLKSSGFHPLFEELFRKYWKGEKDFC

Enzyme Prediction     

No EC number prediction in KAG1689379.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	19	188	1.8e-25	0.642023346303502

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	2.77e-33	14	190	54	241	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	3.67e-26	13	189	47	214	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	1.29e-10	42	187	103	266	galactinol synthase
133037	GT8_A4GalT_like	1.54e-10	52	188	96	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
227884	Gnt1	1.73e-09	37	75	153	191	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55795.1|GT8	4.47e-48	23	221	176	369
CAE7208334.1|GT8	3.49e-30	10	188	122	299
AEO64730.1|GT8	3.81e-30	6	187	179	365
BDA41252.1|GT8	2.94e-28	20	177	124	273
CAP61464.1|GT8	4.00e-27	8	194	139	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	1.20e-13	42	197	100	251	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
3USQ_A	3.91e-13	40	204	103	258	Structure of D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
3Q4S_A	7.83e-13	40	204	84	239	Crystal Structure of Human Glycogenin-1 (GYG1), apo form [Homo sapiens],3QVB_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP [Homo sapiens],3U2W_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens],3U2W_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens]
3USR_A	1.00e-12	40	204	103	258	Structure of Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
1ZCY_A	1.43e-12	40	204	103	258	Chain A, Glycogenin-1 [Oryctolagus cuniculus],1ZDG_A Chain A, Glycogenin-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	9.52e-24	10	187	209	392	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q4WBL2|GNT1_ASPFU	1.57e-19	2	204	127	345	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q9R062|GLYG_MOUSE	1.25e-11	40	189	83	222	Glycogenin-1 OS=Mus musculus OX=10090 GN=Gyg1 PE=1 SV=3
sp|O08730|GLYG_RAT	1.25e-11	40	189	83	222	Glycogenin-1 OS=Rattus norvegicus OX=10116 GN=Gyg1 PE=2 SV=4
sp|O15488|GLYG2_HUMAN	1.30e-11	40	214	116	283	Glycogenin-2 OS=Homo sapiens OX=9606 GN=GYG2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAG1689379.1.