CAZyme Information: KAG1688503.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1688503.1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	JADEVP010000121|CGC1	88320.58	8.2948

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000121:52857-55214(-)

Full Sequence      

MILDVSPRESCALLVFSVALLTAWNANTNGFVWDDRSAVLNNADTQSSSLWDVFSHDFWG
TDIQSVDSHKSYRPLTILSFRLNFWMAKGHSAWLYHFTNALVHASCSVLVWKVADVLFQQ
HQRQTRSVSYKENPQDSSPTVVSAKQKVTSEEGWENLLGSLTTGLLFAVHPIHCDAVASI
VGRADLLCTLLSLAAFLVYVEGAKKKETKWTFVTLALGLTIAAGLCKELGFTNFALLVVY
DLLRIHHYQRDMRGFRLTMGRVAVTVSVGSFVALVRVWINGEHRQMEWNILANNVAVQEN
RLVRILSYMHLHVWYLWKLVWPRWLCFDYGYNTIPVIESIFDPRNVYTFFGYLVVAIGLH
CAILRRFGSRKTPPSSLLMMSIAFGVVPFVPASNIIFPVGTVVAERLLYFPSVGFCLLIG
CVLDQTFSIVQNYPQDPSLDMKHCQVPSLTHSKRLLNGVRLVVLTCSALILTAGCYRSHI
RNADWIDEQMLFKVAVEVVPTNVKVLSNEAKNLLNPDPAKALDYLRVSIGMIPKHIESHL
NAGLAFVTLAARSEMGDQLYLLGIRHLYKSAMLAPAQFYAPGYIGGEIYAHWLKTQRRKG
DNTIEKFLSSKSILYAVKFLDRALELESINPSHYYNRGRIAYEVGDFDSAIKYFRATEMA
NGIIRDRKVDPELLVEASSIYNMLGVCFKGIGEMEKALDMLRKGIALYPSETNLHINAVL
ILLDLGKTEEAAQQLQAGLTVATTLEHAQKLRNIVRKLAKSVIPEIVETILDRTTELEIE
HTNPL

Enzyme Prediction     

EC	2.4.1.109:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	82	247	2.9e-32	0.9389312977099237

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400627	DUF1736	1.14e-18	293	356	11	74	Domain of unknown function (DUF1736). This domain of unknown function is found in various hypothetical metazoan proteins.
276809	TPR	8.94e-12	634	739	4	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	1.69e-09	616	706	20	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
223533	TPR	1.92e-08	512	739	71	263	Tetratricopeptide (TPR) repeat [General function prediction only].
276809	TPR	2.43e-05	680	739	3	62	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
Q5T4D3|GT105|2.4.1.109	1.59e-65	4	513	15	492
BAC25886.1|GT105	4.61e-65	4	526	14	506
BAF83034.1|GT105|2.4.1.109	2.03e-64	4	513	15	492
BAC32288.1|GT105	5.26e-64	4	526	14	506
BAC28522.1|GT105	5.26e-64	4	526	14	506

PDB Hits     

KAG1688503.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5T4D3|TMTC4_HUMAN	2.82e-66	4	513	15	492	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q8BG19|TMTC4_MOUSE	9.34e-65	4	526	14	506	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
sp|Q8BRH0|TMTC3_MOUSE	9.50e-60	4	580	8	525	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q6ZXV5|TMTC3_HUMAN	7.74e-59	14	580	11	520	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q7K4B6|TMTC3_DROME	5.97e-57	6	561	29	572	Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000609	0.999361	CS pos: 30-31. Pr: 0.8705

TMHMM  Annotations     

Start	End
180	202
215	237
257	279
346	368
378	400
407	429