CAZyme Information: KAG1685441.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1685441.1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		31675.75	4.4091

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

Full Sequence      

MLAGAALSSLIAFATFASYTEAHGYLEQPKPSWKDGPNVNWVTLVDNYWDIGSGGDQVGK
FKTMAKEKGMSVKDVVLDMVKDQKCGNTLADGPAQPIPSDGKVKWLGNNGGGFTHTGPCE
IYLDDKMVLHGDDCEDEFQGGDVGSKKTSDMTVDFSSCNGKCLLTIYWLAFQNAQWQTYV
NCVPLEGSGGGGASSPTTQGSSTGTGGSGNDDTEQKTTDAPSTEQQTPEAPSTGSKPSET
SSNEQQAPEASSTGEKAPESPAAETPAATTQATQAPSTPEAPATEDTKCKAPGRRLRKKL
ASA

Enzyme Prediction     

No EC number prediction in KAG1685441.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	12	266	4.9e-64	0.9306122448979591

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411474	fibronec_FbpA	8.47e-06	211	284	154	248	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
411474	fibronec_FbpA	1.14e-05	212	283	189	256	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
237030	kgd	1.11e-04	211	287	40	116	multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.
183854	PRK13042	1.18e-04	214	285	27	93	superantigen-like protein SSL4; Reviewed.
166942	tatB	2.32e-04	214	282	74	141	Sec-independent protein translocase subunit TatB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETP52131.1|AA17	ETP52131.1|AA17	8.94e-127	6	303	3	292
ETP24138.1|AA17	ETP24138.1|AA17	3.88e-126	1	300	1	291
ETI54329.1|AA17	ETI54329.1|AA17	5.14e-126	6	303	3	292
ETO83077.1|AA17	ETO83077.1|AA17	1.04e-125	6	303	3	292
ETN14469.1|AA17	ETN14469.1|AA17	1.11e-125	1	303	1	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	6Z5Y_A	1.01e-29	23	187	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

KAG1685441.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999752	CS pos: 22-23. Pr: 0.9769

TMHMM  Annotations     

There is no transmembrane helices in KAG1685441.1.