CAZyme Information: KAG1684419.1

Basic Information

• Species: Phytophthora capsici
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora capsici
• CAZyme ID: KAG1684419.1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843	JADEVP010000236|CGC1	92350.74	5.2869

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcapsiciLT1534	28579	763924	5206	23373

• Gene Location: location=JADEVP010000236:15420-17951(-)

Full Sequence      

MIVAKDLVLVLALCWASELALAAPITPAAHERVYDAQTSVFDDLLSPAELSVASKDVDID
ALIANMTIRQKAAQMTQMDIYSMLNGDERDPKKALNRTMTAQYARAGVGSILNSPFAGGP
VGGRTGWSVSDYREVIGQIHDIYKEEGALPMLYGIDTTHGASYVKGATLFTQPISAAASF
NPDLVFRMGAVAAKDTLSAGVPWVFSPVLGIAVQPKWSRVLETFGEDPFLASVMGAALIK
GLQSSGKVAACMKHFIGYSNVREGLDRADNVITDWELVNYYAPSFLAAVRAGVLTAMESY
VSVNGEPVIASKKLLVDLLRHDMNFTGLLVSDWAEVDRMYYEHHLVPSVAEAVRVSWQET
SLDMNMSPNLKAFGDTIESLVTKGLLSERRLDESVRRILETKRDLGLLESNYYDEFKRDD
GLNSTVGSPEDQEDALKLAQESVILLENHNSTLPIDLKETTNLFVTGPVSDNKGFMCGGW
SVFWQGSSDSKAFPNGVTFKEAVQAKAASSGGQVKVDHLDVVDIEGKVNPQDFQRGLQLA
AKSDYTFIVLGESNYAEKSGDLHGSLALPAGQLWYLEELTKLKSTKVILVLVPGRPRLLE
GAHNHADAVLLSMLPCEQGGQALADVIFGDVNPSARLPITYPSRVTQLLPYFHRVNTRCQ
PFDECPVQWHFGHGLSYTKFEYSSLHLNSTHVHATTGALEVSVTVTNRGNRPGKEVVLLF
VSQKFRRASVPETKLLKAFKKLDELKPGESKKVEFVLAPEHWSYYKPYVVGRGFQWQAEP
GEFVISLLPSSTDSLTTTTSRPQDESGYMHSQNANRGGPSTDRLVADTESASELSVSFFV
ESE

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	148	352	1.5e-58	0.8981481481481481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.27e-106	42	783	21	746	beta-glucosidase BglX.
224389	BglX	7.66e-67	66	483	1	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.43e-52	134	763	64	749	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	8.92e-52	67	400	1	315	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	6.78e-36	443	677	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27116.1|GH3	8.80e-200	75	791	1	703
UIZ29009.1|GH3	8.79e-199	38	791	7	744
UIZ29613.1|GH3	1.12e-182	54	787	69	795
UIZ29432.1|GH3	2.50e-181	54	787	24	739
CCA27737.1|GH3	1.02e-172	51	804	60	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.72e-103	63	785	21	737	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	5.37e-78	48	793	3	743	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.70e-77	48	793	3	743	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z9S_A	1.28e-75	62	799	31	784	Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5TF0_A	2.08e-75	59	797	13	746	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.16e-130	52	785	73	809	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.93e-102	63	785	43	759	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|Q56078|BGLX_SALTY	2.37e-79	37	783	16	746	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	2.28e-78	37	794	16	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	1.10e-72	147	799	64	719	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000189	0.999797	CS pos: 22-23. Pr: 0.9785

TMHMM  Annotations     

Start	End
7	29