CAZyme Information: KAF7631756.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7631756.1
• CAZy Family: GT58
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase [Source:UniProtKB/TrEMBL;Acc:A0A7G5IV91]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	AAIH03000011|CGC18	38452.16	4.4745

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000011:1266356-1267474(-)

Full Sequence      

MLFSYLLATLPLLANAALTYKGADISSVFIEEKAGVAYKNLAGETQALEAILTDNGVNSI
RQRVWVKNGDYDLTYNVNLAKRVAATGASIYLDLHYSDDWADPKHQTTPDGWSTDDINTL
ADQIYQYTLSVCNTFAEEKINVEIVSIGNEITSGLLWPLGKTPNYENIARLLHSGAWGVK
DSKLATKPKILIHLDNGWDWDQQKYFYDTALGTGLLTSDDFDMIGVSYYPFYNEKATLAS
LKTSLTNIQTTYGKEVAVVETNWPVKCSSPEFAFPADLKDIPFSVDGQVTFLQRLADTLT
ATKASGFFYWEPAWTKNAGLGSSCEDNLLVDYNTNQVRSSVKAFGQV

Enzyme Prediction     

EC	3.2.1.89:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	20	339	3.5e-99	0.9853801169590644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	1.32e-122	20	344	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	2.46e-64	21	347	41	394	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW27283.1|GH53	3.71e-259	1	347	1	347
QRD81653.1|GH53	3.71e-259	1	347	1	347
UDD55123.1|GH53	1.51e-258	1	347	1	347
BAE57004.1|GH53	4.33e-258	1	347	1	347
QMW39354.1|GH53	6.16e-258	1	347	1	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BF7_A	6.20e-175	4	347	5	350	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1FHL_A	2.38e-163	17	347	1	334	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
1HJQ_A	5.29e-138	17	347	1	332	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1HJS_A	2.02e-135	17	347	1	332	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1R8L_A	3.55e-37	21	314	26	324	The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NNI2|GANA_ASPFN	6.59e-260	1	347	1	347	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=galA PE=3 SV=1
sp|Q2UN61|GANA_ASPOR	7.70e-259	1	347	1	347	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=galA PE=3 SV=1
sp|Q0CTQ7|GANA_ASPTN	1.11e-178	6	347	2	349	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1
sp|Q9Y7F8|GANA_ASPTU	1.27e-175	1	344	1	347	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
sp|Q5B153|GANA_EMENI	2.97e-174	4	347	5	350	Arabinogalactan endo-beta-1,4-galactanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=galA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000271	0.999702	CS pos: 16-17. Pr: 0.9801

TMHMM  Annotations     

There is no transmembrane helices in KAF7631756.1.