CAZyme Information: KAF7630573.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7630573.1
• CAZy Family: GT32
• CAZyme Description: Glycosyl transferase family protein [Source:UniProtKB/TrEMBL;Acc:B8NS65]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	AAIH03000059|CGC1	35706.72	6.0349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000059:1454801-1455875(+)

Full Sequence      

MVDIPERPRVTDSKKVWCSILTNTAYLPGILTLEYSLRKHDTKYPFIVLYTDSLPEEAHA
ALDARGILKQPVPYLKPAMTTDLTQDRRLYDAWTKLIAFALYEYDHVVLLDCDMMVLHNM
DELMDVELDPPEMGGKGKRVFGSTHACVCNPLKRPHYPADWIPANCGWALQHDTPELAQT
TAPPIEGSWGLCNTGIIVTRPSEGTWKIITDSLATSNTADWIFADQSLLSEVFQYRWAPL
PYIYNALKTKRWEGVHDAIWRDDRVKNIHYFLTPKPWDETPPVHADPTHAWWCALNAERK
EHDKARGLTDGH

Enzyme Prediction     

No EC number prediction in KAF7630573.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	14	280	6e-39	0.8871595330739299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	8.48e-56	16	292	2	233	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	2.62e-11	23	277	32	266	galactinol synthase
279798	Glyco_transf_8	2.06e-08	18	280	2	251	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133064	GT8_GNT1	2.98e-08	22	123	8	111	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
132996	Glyco_transf_8	2.56e-07	22	278	8	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW24900.1|GT8	2.65e-248	1	312	1	312
QMW36899.1|GT8	2.65e-248	1	312	1	312
UCK57232.1|GT8	2.65e-248	1	312	1	312
QRD89193.1|GT8	1.39e-247	1	312	45	356
UCK57233.1|GT8	1.91e-186	79	312	1	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	4.48e-11	14	292	7	253	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UNW1|YR707_MIMIV	9.61e-17	20	278	10	235	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1
sp|Q9FXB2|GOLS2_ARATH	2.88e-15	4	277	11	266	Galactinol synthase 2 OS=Arabidopsis thaliana OX=3702 GN=GOLS2 PE=1 SV=1
sp|Q9XGN4|GOLS1_AJURE	1.31e-14	13	280	21	269	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|O22693|GOLS4_ARATH	1.33e-14	4	280	12	270	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|Q947G8|GOLS1_SOLLC	7.28e-14	11	309	13	291	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF7630573.1.