CAZyme Information: KAF7630555.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7630555.1
• CAZy Family: GT32
• CAZyme Description: Cell wall glucanase (Scw4), putative [Source:UniProtKB/TrEMBL;Acc:B8NS47]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	AAIH03000059|CGC9	35906.54	5.8374

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000059:1406898-1407983(-)

Full Sequence      

MKWLICVLVVLLLSLQVKALPHESLDQSDPAPLSGVAGKHEIPINGDPNNLPPLLPIPDP
ATPDLVPSLPIEGGYGISYAPYNDDGTCRSLDGINKDLDKISEHYSYVRIYGVDCDQTQN
IVSAARQRNLRVFAGLFDLQNFPNSLDQIIWAAAGDWSTFHTISIGNELVNKGQNPQDVV
TAVHTARAKLRAAGYQGPVVTVDTFSVLLKHPQLCEASDYCAANCHAFFDANQIPDNAGK
YALEQANRISAAAGGKRTVIAESGWPYRGQANGKAVPSAWNQAIALYALGYSFRDRKDDM
VLFSAFDDLWKQDGPGTHGAEKFWGIMRR

Enzyme Prediction     

No EC number prediction in KAF7630555.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	97	328	2.3e-23	0.8971061093247589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.08e-71	76	327	47	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89175.1|GH17	1.67e-246	1	329	1	329
UCK57248.1|GH17	1.67e-246	1	329	1	329
QMW24913.1|GH17	1.95e-242	1	329	1	326
QMW36913.1|GH17	1.95e-242	1	329	1	326
BAE54672.1|GH17	3.90e-228	26	329	97	400

PDB Hits     

KAF7630555.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	4.91e-67	73	326	125	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	2.76e-62	72	327	134	386	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	1.41e-61	72	327	131	383	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|A1C499|BTGE_ASPCL	1.91e-40	67	327	301	561	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|Q4WC60|BTGE_ASPFU	9.76e-40	71	327	305	561	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000185	0.999818	CS pos: 19-20. Pr: 0.9802

TMHMM  Annotations     

There is no transmembrane helices in KAF7630555.1.