CAZyme Information: KAF7629798.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7629798.1
• CAZy Family: GT31
• CAZyme Description: Glycoside hydrolase [Source:UniProtKB/TrEMBL;Acc:A0A7G5JKI3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
932		101724.38	6.9067

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000068:1234516-1237789(+)

Full Sequence      

MAPREDMLPPGWDDLDRQMGQLFMMGFDGTSVDPQIRSLIENYHLGSILLTAKNLKSAED
ATRLVLELQTIARDAGHPVPLLIALDQENGGVNSLYDEIYIRQFPSAMGIAATGSKALAH
DVAVATAQELKAVGINWILGPVLDVLTNVRSQPLGVRTTGDDPQEVSQYGVEFMKGYKEA
GLVTCGKHFPSYGNLEFLGSQSDVPIITESLEQLSLSALVPFRNAILHGIDSMMVGGVSM
SSAGFHVMHACLSEQVVDDLLRKKMKFDGVVVSECLEMEALTHNIGVGGGTVMAKKAGCD
IILLCRSFPVQQEAITGLKLGVENGIIGRARIEQSLRRVLSLKAKCTSWEQALNPPGLSS
LTQMQPSHTTLSTRAYNSSITVVRDKKTLLPLSNIIEPSEELLLLTPLVKPLPASAVSRS
VTEHPNLSIEPMTWDRTSSVLSGESVFRELGRSLSRQRNGRVLHTSYTANGVRPIHENLI
DRASAVIVVTADANRNQYQYGFTKHVSMICRSQFTPSGESREKPVVVIAASSPYDFAMDP
SIGTYICTYDFTETALEALVKILYGEIIPMGSLPGSINRSQKLHQARQHWLVENWNEERD
SHALDSLLDAVREDCTQTQRSELLGVTSCSFLLRREEIDEAHFVVRNSSTQALYGFCSTY
FFRSTGTGVIGALIVDPARRKLSIGASLHNRAIRTLVQRKGVKRFQLGSRLPGIYLGIPS
ANPVERKRLRQWFANLGWNTALSRPVCSVVLRSLSSWKPPNGLIQGLQNADVVYDLVYGW
DYADTILDHIKTNSRQGVIDIYKVALGGAPNCGIIRATRPGDGAILGSVVTYNGRATLAE
HMPALKAMHSSTGGISSPVISPSVGEYATVMQGLIFMGIKQHRKQGADSVIMDCVDGDSN
FDSLSGIMGFSTLHSFEEVNCDAATWTMMTAS

Enzyme Prediction     

No EC number prediction in KAF7629798.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	303	2.8e-52	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.10e-70	15	401	3	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	5.64e-63	15	342	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.02e-32	19	338	1	308	beta-hexosaminidase; Provisional
178629	PLN03080	1.79e-09	104	574	114	585	Probable beta-xylosidase; Provisional
185053	PRK15098	8.79e-09	15	343	47	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65506.1|GH3	0.0	1	932	30	961
QMW48185.1|GH3	0.0	1	932	1	932
QMW36125.1|GH3	0.0	1	932	1	932
UDD65351.1|GH3	0.0	1	932	1	932
QRD92904.1|GH3	0.0	19	932	1	914

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	3.86e-90	13	738	7	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	7.79e-62	15	577	13	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	9.52e-42	15	577	44	617	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.27e-41	15	577	18	591	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.82e-41	15	577	48	621	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	4.90e-41	15	577	44	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	6.13e-35	16	574	29	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	5.12e-29	30	578	49	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	4.63e-26	24	332	7	308	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|B0U3L0|NAGZ_XYLFM	1.35e-25	22	332	1	309	Beta-hexosaminidase OS=Xylella fastidiosa (strain M12) OX=405440 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF7629798.1.