CAZyme Information: KAF7629400.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7629400.1
• CAZy Family: PL9
• CAZyme Description: Glycos_transf_1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7G5JJK2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667	AAIH03000068|CGC11	75994.90	6.4491

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000068:199436-201763(-)

Full Sequence      

MSEQQQQRKRERDINEGTSWSGRSLTTIYAGISVLHRDYEDSRAAIAFRNSAYLFDYIVF
DLPAESSNTPVHTICNRIVSELRTYSEKHKEKLIGLAMPLLLADKYPPLCPQLWRELDIL
PLVLEHKERARADADQGELATFASWNTKELDEQADSMVRKCLRSFGAGHVLQGEIGLGSL
VGVDRNFRVRLADLQDYQETVNARTWSMAQDYAEELKRRNVKIAFFSLSSHGRPDIHTRH
SLVRFLHYLGVNVQWYVPKPRPGINSIIRKMQDSLEGLGERDDSITVDEEMCILQWVYEN
ARRYWLCEDDPLQARSKGGADIVVIDDVPLTPAALLSKQTDPGRPVIFENRLQVQKGALQ
DASNFSTRPWNFLRERLKHVDLVVSQAPKELLPNIMPQKKVVYIPVSVDQLDGLNKCMSD
FDLTFYGREFNTLCRSFETPTLNYPNEEYILHLSQFRNLDETITVLNAYQKFRSHCMDAG
MNTLFPKLLIYHYGPSRSSRSTLIYDAILSYIETDMPRLKSCIYVMQIGPPDQLWNTLLT
RAKVVIELSMCEGIPAMLLAAVQKGKPIITAKEIGQFSFTKGVNNILFCEKGDADIIARL
LRDLWTDPRLSELLLPGSRRLRDEYTTVGNAVNWLFLAAEMSREGNVVEPDGRSIYELAG
QGAGLCA

Enzyme Prediction     

No EC number prediction in KAF7629400.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340823	GT4_trehalose_phosphorylase	1.32e-103	222	640	1	377	trehalose phosphorylase and similar proteins. Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.
223515	RfaB	2.11e-05	370	626	144	362	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW47856.1|GT4	0.0	1	667	1	667
QMW35794.1|GT4	0.0	1	667	1	667
QRD93295.1|GT4	0.0	1	667	1	674
UDD64944.1|GT4	0.0	1	667	1	668
BAE65846.1|GT4	0.0	1	667	1	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X6Q_A	3.44e-09	194	602	16	378	Crystal structure of trehalose synthase TreT from P.horikoshi [Pyrococcus horikoshii],2X6Q_B Crystal structure of trehalose synthase TreT from P.horikoshi [Pyrococcus horikoshii],2X6R_A Crystal structure of trehalose synthase TreT from P.horikoshi produced by soaking in trehalose [Pyrococcus horikoshii],2X6R_B Crystal structure of trehalose synthase TreT from P.horikoshi produced by soaking in trehalose [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O75003|TREPH_GRIFR	3.83e-88	24	658	35	707	Trehalose phosphorylase OS=Grifola frondosa OX=5627 PE=1 SV=1
sp|A6YRN9|TREPH_PLEPU	6.71e-85	24	658	39	714	Trehalose phosphorylase OS=Pleurotus pulmonarius OX=28995 GN=TP PE=2 SV=1
sp|Q9UV63|TREPH_PLESA	4.76e-78	24	658	39	726	Trehalose phosphorylase OS=Pleurotus sajor-caju OX=50053 GN=TP PE=1 SV=1
sp|O58762|TRET_PYRHO	4.10e-08	194	579	15	351	Trehalose synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=treT PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAF7629400.1.