CAZyme Information: KAF7628876.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7628876.1
• CAZy Family: GT15
• CAZyme Description: Exopolygalacturonase C [Source:UniProtKB/TrEMBL;Acc:A0A7G5IQD5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		47626.10	5.1964

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000072:3773448-3774761(+)

Full Sequence      

MLITKTAFLAFLLSSVPLAHGAGGNSSSPDARGRRCVVRSSNGTADDSPEVSRVFAQCAT
NSVIVFQEGVDYNIFQPIKATNLSNVEIQMHGNLHLPQNISAVRDIVNAGTSTWFTLEGP
RVDWTGPEDVNNGWIKSYGQAWWDANPPNGTGISGRPHLMSYKTSQATIKYFRSGKPIAW
NMKLHGEDIAVSHAIVDASSTGSFPFNTDAFDVQGTNIRISDSIMYNGDDAIAVGSDSHN
IVFERNTIGYQSHGMSIGSLGKDASAFANITNLRFEDVTVIDALYAARFKSWTGGQGLVK
NVTWKNIRVYNVTFPIFVTQSYYDQSVSRDGVDTESSVMMEDFTWEDFSGSINSYQPGDG
SCATDPCWYNAGLPNLKHTEALVIECNTDKSCKNFVTKNIQLYPQVLEPASVICMKATAE
LNPNLGFNCSNGTFTSA

Enzyme Prediction     

EC	3.2.1.67:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	60	418	8.7e-47	0.9507692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.41e-27	103	362	30	293	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	3.31e-22	77	436	101	409	polygalacturonase
177865	PLN02218	2.86e-21	42	367	78	398	polygalacturonase ADPG
215426	PLN02793	2.62e-18	189	432	211	428	Probable polygalacturonase
178580	PLN03003	2.75e-15	42	367	34	347	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW25577.1|GH28	0.0	1	437	1	437
QMW37662.1|GH28	0.0	1	437	1	437
QRD88432.1|GH28	0.0	1	437	1	437
BAE56325.1|GH28	0.0	1	437	1	437
UCK58026.1|GH28	0.0	1	437	1	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	1.13e-14	44	377	28	366	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	3.02e-12	135	363	81	322	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UQ40|PGXC_ASPOR	0.0	1	437	1	437	Probable exopolygalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxC PE=3 SV=1
sp|B8MZZ6|PGXC_ASPFN	0.0	1	437	1	437	Probable exopolygalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxC PE=3 SV=1
sp|Q0CXI3|PGXC_ASPTN	2.26e-254	3	436	3	427	Probable exopolygalacturonase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgxC PE=3 SV=1
sp|A2QEW2|PGXC_ASPNC	3.06e-247	1	435	1	436	Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgxC PE=3 SV=2
sp|Q27UB0|PGXC_ASPNG	3.06e-247	1	435	1	436	Exopolygalacturonase C OS=Aspergillus niger OX=5061 GN=pgxC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999727	CS pos: 21-22. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in KAF7628876.1.