CAZyme Information: KAF7628409.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7628409.1
• CAZy Family: GH92
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		65715.05	6.3028

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000072:2602734-2605663(+)

Full Sequence      

MKFLSVILLTTTAGLASAAGSAGCGQPLPPSQNPGGSSYGVNFTLSAGTQRFYRIHIPSN
YNVKTPTPLIFSFHGRGKTAESQEKLSQFSNEDWNPDAIAVYPQGLNKEWQGDPHSKDVD
DIAFTMEMLDYFQEKFCIDSTRVYAAGKSNGGGFTNLLACDPTASTRIAAFAPVSGAYYQ
DVSEEACHPTTVPIKCSPGRPSIPILEFHGTADKTIPYGGGGRRGECLPSIPHFVREWSK
RLGYGLHNTTKELYDGNVQEYQYGNGDNRGIVTHYRIGGLGHDWPSVRPNSDNPNGTYLD
ATPIIVKFFKQWSRERDNDYICVELVIQNIKHCLTGCDYILRGPTTCLKNQPNTQISFNL
ARPSEVEFLEKLKESKYSVVFKVRFRERICIMKVYHDRGPSEFDPPDREINLFVSESTAY
HRMQLKGLCEKGVIPDFYGTIRNIQPSCWSDLDMFLKDRLPPNAILIEYIPNLQSINLSN
YSEQRLAKLRQILDEIHEANVLHGDPMPRNMMVSLGEQDRVHWLDFDSAQTFPEGGDRSP
KQERWMKEEVELLDYFVDALAQDHKEGKLNRTISYYYDWFA

Enzyme Prediction     

EC	3.1.1.72:1	3.2.1.8:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	48	207	6.1e-20	0.6079295154185022

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	5.78e-40	45	316	41	311	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
273828	esterase_phb	1.11e-08	53	216	1	182	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
223589	SPS1	4.72e-08	365	581	1	196	Serine/threonine protein kinase [Signal transduction mechanisms].
236586	PRK09605	3.32e-04	465	526	413	471	bifunctional N(6)-L-threonylcarbamoyladenine synthase/serine/threonine protein kinase.
237847	PRK14879	6.28e-04	465	526	76	138	Kae1-associated kinase Bud32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO15718.1|CE0	2.03e-32	48	312	32	289
ASY31590.1|CBM13|CE0	2.83e-25	24	310	168	449
UKZ97189.1|CBM1|CE0	3.06e-19	4	228	31	229
UKZ53227.1|CBM1|CE0	1.35e-18	4	221	7	197
CAC85738.1|CBM1|CE0	5.83e-18	23	261	96	308

PDB Hits     

KAF7628409.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y871|FAEB_PIREQ	2.32e-17	55	243	296	482	Feruloyl esterase B OS=Piromyces equi OX=99929 GN=ESTA PE=2 SV=1
sp|B8N7Z6|FAEC_ASPFN	2.51e-13	4	256	7	233	Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=faeC PE=3 SV=1
sp|Q2UI81|FAEC_ASPOR	4.56e-13	4	256	7	233	Probable feruloyl esterase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=faeC PE=3 SV=2
sp|A2QYU7|FAEC_ASPNC	8.28e-13	3	221	6	198	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|Q0CDX2|FAEC_ASPTN	3.96e-11	1	221	1	198	Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999733	CS pos: 18-19. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in KAF7628409.1.