CAZyme Information: KAF7627841.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7627841.1
• CAZy Family: GH76
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B8MX68]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		54771.63	6.0626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000072:1135449-1137074(+)

Full Sequence      

MSSGILKVKGNKIVDNDGNEVLLRGAAIGGWMNMENFITGYPGHESQHRTAMKKVLGPEK
YEFFFDRWLEYFFTEADAKFFAGLGLNCIRIPFNYRHLEDDMNPRVLKESGFKHLDRVVD
LCSKQNIYTILDMHTAPGGQNGDWHSDNFTSYAAFWDYKDHQDRTVWLWEQIAARYRSNP
WVAGYNPLNEPCDPEHVRLPAFYERVEKAIRAVDPDHILWLDGNTFAMEWKGFDKVLPNC
VYSIHDYASMGFPTGERYKGTAEQNAHLERTYLRKVQPLNEKGTAIWNGEFGPVYADPRA
DAEASTINQERYNLLGEQLRIYDKYNIHWSIWLYKDIGLQGMIYTSPDSKWNKTIQPFLE
KKNHFWLDCWGRRPSAEPEAALKPLVEWIDKVSPQAKETYPTPWNTERHLLRNVFQTFLA
ASFADEFAELFRGMNEAELDSLARSFHFEECVQRDGLNEILREHAHARQA

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	337	2.3e-128	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	9.08e-25	70	336	22	270	Cellulase (glycosyl hydrolase family 5).
225344	BglC	5.90e-14	71	335	72	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW26442.1|GH5_22	0.0	1	470	1	470
QMW38521.1|GH5_22	0.0	1	470	1	470
UCK59003.1|GH5_22	0.0	1	470	12	481
CAP80303.1|GH5_22	9.88e-301	1	467	1	467
APA13270.1|GH5_22	8.01e-248	1	468	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	3.71e-22	60	340	16	321	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	9.29e-22	60	340	16	321	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6ZB9_A	3.30e-12	23	267	3	252	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
3W0K_A	5.46e-12	80	335	30	294	Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus],3W0K_B Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus]
6ZB8_A	7.82e-12	23	267	3	252	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	1.15e-183	6	465	4	469	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|P23340|GUNC_CLOSF	7.63e-22	60	340	16	321	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|A3DJ77|GUNC_ACET2	7.63e-22	60	340	16	321	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P0C2S3|GUNC_ACETH	1.91e-21	60	340	16	321	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|A1D4Q5|EXGA_NEOFI	1.02e-16	22	341	41	390	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF7627841.1.