CAZyme Information: KAF7627696.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7627696.1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557		61284.12	4.6000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000072:786078-788181(-)

Full Sequence      

MIVSEGPKWHLLSLLFACLAVQVLSQSVSGTECNNSTPGCELPKVEGNSKPFEQQKCSGA
TSKQRYIGYYYPGHFEGRDCETLEPSDINVEPFTHLYLYGPHIRDKGPIAAPNNDIDRRR
WKDFVNLKIKKPSLKTFISVTPYPLDSGNRVPFLLNAVGSFENRTDIIDSIVQVMDEFKF
DGFNFAYTWRDLWQNDPKNSVLFLKELRKSFGDKYGLAAEFRATECALRNIDLPGMFEHL
DHANFVSYDSSIDVACKDEEKWLSFPAALNIERSARLFRQANIDPNKLSPILVLGGQEWK
LLDPKCKTPECPAETRPSRGKCDTYTNYQLSNYDVDRLMRSSYPEEPEVHYNISTAYSWV
TFESARSLKAKADLANENCLGGLAVEMVYTGGPATLANPNDLDPINTSMESAPPTNPLQD
FDPNAQLTVTDTPSTTSTQSASLSTDTSTTDTDTNVNTEGLSCHPAIGSVHVPIAQQDCD
SNSTSTASHSPDTPVNAEEHTPSPTLAAPHDASTSDEPNAMGPKPTLTLAYRIGTPTDAA
EKANDEGTTPGEPANAP

Enzyme Prediction     

No EC number prediction in KAF7627696.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	64	385	2e-28	0.9155405405405406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	1.17e-33	67	385	3	328	Glyco_18 domain.
395573	Glyco_hydro_18	1.02e-26	65	385	1	301	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	1.56e-18	66	249	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119351	GH18_chitolectin_chitotriosidase	2.89e-18	84	390	19	337	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
119365	GH18_chitinase	1.20e-14	67	383	2	314	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD87317.1|GH18	0.0	1	557	1	557
QMW38636.1|GH18	0.0	1	557	1	561
QMW26557.1|GH18	0.0	1	557	1	561
UCK59140.1|GH18	0.0	1	557	1	557
QSS62098.1|CBM18|GH18	2.00e-52	52	414	119	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	4.35e-18	89	390	27	349	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6JM8_A	4.35e-18	89	390	27	349	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
1E9L_A	1.31e-10	70	385	6	338	The crystal structure of novel mammalian lectin Ym1 suggests a saccharide binding site [Mus musculus],1VF8_A The Crystal Structure of Ym1 at 1.31 A Resolution [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q91Z98|CHIL4_MOUSE	1.03e-10	70	385	27	359	Chitinase-like protein 4 OS=Mus musculus OX=10090 GN=Chil4 PE=1 SV=2
sp|O35744|CHIL3_MOUSE	7.39e-10	70	385	27	359	Chitinase-like protein 3 OS=Mus musculus OX=10090 GN=Chil3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000211	0.999759	CS pos: 25-26. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in KAF7627696.1.