CAZyme Information: KAF7627478.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7627478.1
• CAZy Family: GH72|CBM43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	AAIH03000072|CGC9	50744.83	4.8799

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000072:263052-265249(-)

Full Sequence      

MGRRTPVYRAAQTCILGLILLSFASASSYLPRESPTGIISNDGFSFLNETSQLTPRDEKP
FTLRIMPLGASITYGYQSTNGNGYRRWLRQQLRHAGWWVNMVGSNPNDTSTMNDNEVEAT
SGFRVDQVTQQAERPIPQQPNLILINAGTNDANQYHDTTVDHYTHVYKNTGHGGTQVKGD
GVYCCDIRGTGADDYVWISSEGQGYLYGNVHDPPVWKPEGIEIFNVKKDRKSLHLADIDG
DGNAIYGSDNAQGDYFQYKGVLTGNARCTQGWGVGLYDLGLRFADLDGDGRADYLCMDPD
GRTDGWLNKGENSFESIGQVKRSEHYDRANHRWADVNGDRMADFLWIDKFNGDTKVWINQ
GPVPTLDSKWRCGPQDGPRYMGADRGANMHFPNLGGLGRADYHQVIPRTNIAYTWFNECP
NEALDDDDSTEDPKLPQYPAPAQPASINNNGANDAM

Enzyme Prediction     

No EC number prediction in KAF7627478.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	63	157	3.3e-29	0.4793814432989691

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.31e-08	63	158	1	59	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404411	VCBS	1.45e-06	285	346	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
404371	Lipase_GDSL_2	2.49e-05	68	159	2	81	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	4.09e-04	68	170	4	96	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404411	VCBS	0.004	237	295	1	60	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD56943.1|CE0	2.12e-109	161	444	579	870
AEO70515.1|CE3	3.18e-62	161	410	610	882
CCT73237.1|CE3|GH43_30	1.42e-60	166	438	615	900
EAA58486.1|CE0	2.17e-47	166	439	616	920
ABA65775.1|CE0	3.43e-47	162	442	609	919

PDB Hits     

KAF7627478.1 has no PDB hit.

Swiss-Prot Hits     

KAF7627478.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000531	0.999417	CS pos: 26-27. Pr: 0.9744

TMHMM  Annotations     

Start	End
7	29