CAZyme Information: KAF7626713.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7626713.1
• CAZy Family: GH65
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429		48344.61	5.7781

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000077:1359476-1361155(+)

Full Sequence      

MYYTLNFRMNESFMAVLLGCYIGLRVDGRSTQFKYHKSPFPAGGSGLGVKTGNGLLDQDQ
GSDCATRFDASVNLRYFDTASSTKSCRGSIFSLHAYNLDARCYDTRNNAASSPPIARALP
ARTLLSRPLSRDGTTIPKIIHQTWFPAGSNMSERAQDWVHGMRTQNSDWEYVLWDDETNR
MLVEQYFPWFLQTYDSLPKEILRADVVRNLYMYLFGGMYADVDTEALRPVAPLFAGHETA
LAAHEDILSSAPSFQKTTVQRAFLGRMARTVDILSSAAVPNGWMASPPGHPFWLLPVLNV
IEHPEGTGDGSVEGLTGPGALSLMIKKYWDNFKDNSLREHACKTIQRRQASWQLFCDESE
LAMGAHMQDALVLLPEKQIYPFSWVDDANNASVCQAAWENPTFDPEECKRLMEVEAWPSY
FITYCTHSW

Enzyme Prediction     

No EC number prediction in KAF7626713.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	155	233	1.7e-17	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.12e-27	134	339	80	250	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.53e-14	152	233	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD92713.1|GT32	4.64e-246	110	429	43	362
QMW36295.1|GT32	4.64e-246	110	429	43	362
QMW48351.1|GT32	2.68e-245	110	429	43	362
UDD65556.1|GT32	2.68e-245	110	429	43	362
BCS10897.1|GT32	1.40e-155	116	429	58	371

PDB Hits     

KAF7626713.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	3.88e-19	130	233	51	152	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	1.30e-17	136	335	62	232	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.64e-16	136	328	64	229	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P33300|SUR1_YEAST	1.58e-15	136	338	55	228	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.58e-15	136	328	82	243	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.815083	0.184923

TMHMM  Annotations     

There is no transmembrane helices in KAF7626713.1.