CAZyme Information: KAF7626601.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7626601.1
• CAZy Family: GH55
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824		91577.66	6.1134

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000077:1110892-1114077(+)

Full Sequence      

MADEKDGQLHENDQVLDETSNPPPAYSPPACSIASSEASLWTVEPDFAPYFTNTSHQGSG
CAAVGENQELSTNLRFGSRTSAFIQAFLRPNTQPRLVSVRSDSHALPEDCPSDRQMQPEL
RGVPLDIVIMVAGENIEPFVAVGKRLLGDSHRVRIAAHVSCESIVKDQGLDFFAISHDVI
HPMSNIGSREGTRGSNAMNEGIGRIKRSLYQSYHESWRACIASYKSESRPFLADAIIANP
LAHAHIHCAERLSIPLHIMSAMIWSPTKEFPHPLAHIDGSEDMDQVMANVLSYALVEETI
WKTIIEPINRYRQHVLGCQSISSATGGRLMIDNDIPHTYFCPEVLVSRPGDWDDMINTSG
YVFVEEEAQYSPAKDLSSFIESGSPPIYFLLQENSMESPGMLARAIQDIVVKHGLRAILS
QGCRDTCRILNDDNVLLVDSIPYAWLLPRVAVVVHSGSADQSALALQYGKPSVVIPHTAD
QLSRGIKLSSIGATAAPLMSNMFSPDALYQALEFCLRPDVQESTRVVQKQVHDESGLESA
IKAFYRWLPPQVQKCDITNQNLAMYQIWNRPSMRISPEVAAVLLEEQLIKQTDIVLITRQ
VYNIQCESSRPIEDIARDHWKRVTIAAKSIVTASDLVSMLPGMQRKSDDSSVEKPKRKNL
TKDVGIDAARFFGNIALLPFTSTALVINTVAYGVKGVRGSKTRDEESAATDIVASYDESE
LPQSDSPRINETRQRPSMMQDSGIINRATGLRKQSNLNASDFSTEPNTENKRKELPSSVQ
TSRIQARDEEHAEAICRRHLDRGFRSPRLKCLDFRKLVIDKYQS

Enzyme Prediction     

No EC number prediction in KAF7626601.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	230	545	1.1e-18	0.7486910994764397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	6.14e-27	136	547	14	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.75e-16	127	546	4	400	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	6.40e-07	127	271	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW36383.1|GT1	0.0	1	824	1	808
QMW48437.1|GT1	0.0	1	824	1	827
UDD65656.1|GT1	0.0	259	791	1	538
QRD92604.1|GT1	0.0	134	596	6	470
CAK37759.1|GT1	2.17e-227	1	824	1	794

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.50e-34	135	548	32	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.31e-34	135	548	52	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	5.84e-64	113	552	143	578	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	2.75e-61	124	553	192	615	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|A7ERM5|ATG26_SCLS1	4.39e-41	124	546	939	1355	Sterol 3-beta-glucosyltransferase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=atg26 PE=3 SV=1
sp|Q0CKU4|ATG26_ASPTN	4.90e-38	135	546	910	1313	Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg26 PE=3 SV=1
sp|Q0UY53|ATG26_PHANO	5.05e-38	124	548	952	1370	Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF7626601.1.