CAZyme Information: KAF7626268.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7626268.1
• CAZy Family: GH5
• CAZyme Description: Probable mannan endo-1,4-beta-mannosidase A [Source:UniProtKB/Swiss-Prot;Acc:B8NVK8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		42008.22	4.3540

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000077:321447-322705(+)

Full Sequence      

MKLNPSLLTAAGLVSAQLASALPQASSSTVSPSPSPSATPGSFVTTSGLNFVIDGKTGYF
AGSNSYWIGFQKNNDDVDLVFSHLQESGLKILRVWGFNDVNQKPTDGSVYYHLLADGTAT
VNEGEDGLQRLDYVVSSAEKHGIKLIINFVNFWDDYGGINAYVKAFGGSKEDFYTNDAMQ
AAYRAYIKAVISRYSDSTAIFAWELANEPRCQGCETTVLYNWIESTSQYIKSLDSKHLVC
IGDEGFGLDTGSDGSYPYQYSEGSDFAKNLAIPTIDFGTFHLYPSSWGTTNDWGNGWVTS
HGAACKEAGKPCLFEEYGVTSDHCAVEKPWQNTALNTTAISGDLYWQYGDQLSGGPSPDD
GNTFYYGTDDFKCLVTDHIAAINSRN

Enzyme Prediction     

EC	3.2.1.78:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	75	348	3.8e-91	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226444	COG3934	2.44e-28	51	378	4	305	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
395098	Cellulase	4.11e-10	86	321	27	240	Cellulase (glycosyl hydrolase family 5).
225344	BglC	3.41e-07	47	295	32	293	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD92290.1|GH5_7	2.57e-292	1	386	64	449
QMW48707.1|GH5_7	2.57e-292	1	386	64	449
QMW36651.1|GH5_7	2.57e-292	1	386	64	449
UDD65966.1|GH5_7	1.73e-290	1	385	64	448
BAE66031.1|GH5_7	1.87e-290	1	385	1	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WH9_A	1.03e-193	42	384	1	344	The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger],3WH9_B The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger]
3WFL_A	6.83e-182	43	382	3	342	Crtstal structure of glycoside hydrolase family 5 beta-mannanase from Talaromyces trachyspermus [Talaromyces trachyspermus]
1QNO_A	1.54e-157	42	383	3	344	Chain A, ENDO-1,4-B-D-MANNANASE [Trichoderma reesei],1QNP_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNQ_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNR_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNS_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei]
3ZIZ_A	3.17e-154	47	384	19	356	Chain A, Gh5 Endo-beta-1,4-mannanase [Podospora anserina]
4AWE_A	1.17e-78	40	386	3	385	The Crystal Structure of Chrysonilia sitophila endo-beta-D-1,4- mannanase [Neurospora sitophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NVK8|MANA_ASPFN	4.21e-294	1	386	1	386	Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=manA PE=3 SV=2
sp|Q2TXJ2|MANA_ASPOR	3.32e-291	1	385	1	385	Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=manA PE=3 SV=1
sp|Q0CCD0|MANA1_ASPTN	5.93e-219	1	385	1	384	Probable mannan endo-1,4-beta-mannosidase A-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=manA-1 PE=3 SV=1
sp|Q0CUG5|MANA2_ASPTN	1.78e-201	1	383	1	388	Probable mannan endo-1,4-beta-mannosidase A-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=manA-2 PE=3 SV=2
sp|Q00012|MANA_ASPAC	4.20e-200	1	386	1	376	Mannan endo-1,4-beta-mannosidase A OS=Aspergillus aculeatus OX=5053 GN=manA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000337	0.999618	CS pos: 21-22. Pr: 0.9851

TMHMM  Annotations     

There is no transmembrane helices in KAF7626268.1.