CAZyme Information: KAF7625727.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7625727.1
• CAZy Family: GH43|CBM91
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
151	AAIH03000093|CGC11	17010.14	7.2197

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000093:2261431-2262108(-)

Full Sequence      

MEAPINDFNGPGLYLFQVQHSKKYLDLDESKKANHTKVQQWEARKHHEDQNWVVAAAGHD
EYLILADKAGTCLTAPEKDREPATGNLKSATDKHIRWKFVCAEDGAYFVHSVAHPNSVLD
VQGISHENGAPVLVFPLNKQKNQQWKLVATK

Enzyme Prediction     

EC	3.2.1.8:18	3.2.1.55:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	14	148	1.2e-16	0.675531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404972	RicinB_lectin_2	3.18e-07	50	135	3	89	Ricin-type beta-trefoil lectin domain-like.
395527	Ricin_B_lectin	1.01e-06	20	145	9	126	Ricin-type beta-trefoil lectin domain.
404972	RicinB_lectin_2	1.97e-05	96	150	4	57	Ricin-type beta-trefoil lectin domain-like.
404972	RicinB_lectin_2	1.09e-04	10	73	11	73	Ricin-type beta-trefoil lectin domain-like.
238092	RICIN	1.15e-04	27	147	13	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW39033.1|CBM13	9.09e-19	12	147	33	171
QMW26953.1|CBM13	9.09e-19	12	147	33	171
UDD54762.1|CBM13	9.09e-19	12	147	33	171
QRD81276.1|CBM13	9.90e-19	12	147	33	171
BAE64529.1|CBM13	9.90e-19	12	147	33	171

PDB Hits     

KAF7625727.1 has no PDB hit.

Swiss-Prot Hits     

KAF7625727.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF7625727.1.