CAZyme Information: KAF7624911.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7624911.1
• CAZy Family: GH33
• CAZyme Description: Glycosyltransferase family 25 protein [Source:UniProtKB/TrEMBL;Acc:B8N5M0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	AAIH03000093|CGC17	38449.80	7.0715

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000093:214466-215564(-)

Full Sequence      

MKRTQPLSINTLRNIAIVGAFVLLICRTFQAPLIEKLKPQHTHHKGGFAPLNNTLGFEKI
AIVSTGTAWRLDGLLRAAKYTHVDLEVPLQPPWSDDEVDVFRGKGVPGRAGHIGRGQARC
WLGHLNIWREMIAQNWATVLVMEDDADWDIAVKQQLLRASPLIRQVSGDKGQVDWSPYGE
AWDLLWLGHCGDYIPESPASFMDETLPESSLYRENDGRLTNFPSHLRMVHKSVAPICTYA
YALTKPAASKLYELSRQGMDRIITDYLREWCQSGTLRCLTVNPEVFHHHKQAGEVSSDIA
VVEGWDDLAAKANSDYTANIRFSARCSSNAGRPVACQNEFGGVM

Enzyme Prediction     

No EC number prediction in KAF7624911.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	114	255	1.4e-18	0.5966850828729282

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	4.60e-09	109	149	61	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89444.1|GT25	1.58e-263	1	344	1	344
QMW30566.1|GT25	1.58e-263	1	344	1	344
QGA19766.1|GT25	2.99e-101	62	339	2	280
UDD59205.1|GT25	1.92e-52	52	332	67	356
QMW28939.1|GT25	2.71e-52	52	332	67	356

PDB Hits     

KAF7624911.1 has no PDB hit.

Swiss-Prot Hits     

KAF7624911.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996890	0.003140

TMHMM  Annotations     

Start	End
12	34