CAZyme Information: KAF7624882.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7624882.1
• CAZy Family: GH32
• CAZyme Description: Bac_rhamnosid6H domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B8N5K1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797		90189.03	5.7013

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000093:150071-152643(-)

Full Sequence      

MVTPDEQKIINSLQANWIWTPDWVDSSRVNTTGRIVHFSRELDLPESPTRAELHFSADTR
YKLYVNGVRVAVGPARSSPWIWYYDTLDIAPYLSRGRNVIRFVVVRYFASSRGAMPFERT
TLPGLTVVGSIEAGSNVVELDSHKGWQAQVDESIQFPMGLIDDGFLHIYERVAPTIHSPS
VTPKAYGIKTLNGDLPPWRLRPRGIPMPDQTPIVVNVVRACESYISAEEWSSCLSGGGPL
TLRGRSSHMLELQADTHSTAFLRWAFQGITNASQITLKVTYSEGYELEPRSYPYFRKKTD
RLDAKAGHLIGPYDAVTLDIPDTQTVAYEPFWFRTFRLLRLEIIVGEEPVRMLPLEATQV
NYPLAVKASWTELGDEYSERIWDVSIRTMRNCMFDGYSDCPFYEQLQYSGDSRAVGLFHY
LLSGDDRLMRQAITNFAASVTFEGLTQSRFPSHVPQLIAGFPLYWVLQVCDHHLYFGDTR
FARSFLPRIDGVLDFFDVHIDTLGLVSGLPEDVWQYVDWVTTWGATEDYPDKGVPTSGRK
SNRHTYFSMLYAYVLQQAARLVRDVGRPGYAEEYEARAAALQQAIRAHCYDGHFFTDSTA
DIADEMSYSQHCQVFAVLSGTARPEDHARLLMESFADSRFAKCSYMMRFYALRALSLAGD
QVYDSFWPQLWDPWRNMLANNLSTWEEDDVRQRSDCHAWSSVPIYEYCTELAGIRPIAPG
SSKILFKPRLGLSDAIQAKVALGKDNVATISWTMGGGGEKNVELRLEKPVEIVSQLPGGL
EEEHGVTDCVKLVHKAG

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	273	771	1.5e-92	0.9285714285714286
CBM67	15	154	3.6e-25	0.75

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.37e-11	367	705	2	334	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89417.1|GH78	0.0	1	797	1	797
QMW30547.1|GH78	0.0	1	797	1	797
BAE60295.1|GH78	0.0	1	797	1	797
QMW42605.1|GH78	0.0	1	797	1	797
UDD59362.1|GH78	0.0	1	797	1	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	9.99e-35	334	783	503	948	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

KAF7624882.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAF7624882.1.