CAZyme Information: KAF7623710.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7623710.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	AAIH03000103|CGC1	35800.12	6.7158

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000103:233520-235000(-)

Full Sequence      

MAPHTTVADFSPDECCGEQFFTFTSAKGELAPHLPRLRLVGQNDLPLVETFVPCCGESLD
IILDTARAACAIDYPTARFCVTVLDDGNSAALHKAIADLCKIWPNLSYHSRGVKPNVKVF
AKAGNLNYGLFEIKRPFPPEFIAVMDADYMPTPDFLRATLPHMLTRSKLAIVESAQYYYN
LPDGDPLDQALDYYSAIKIPQLNRLGKSFASGSGCVIRYNTLLKTGGFPTFGSVEAVTLS
SILTQSGYQILVLTEMAQLGISCINLSSLERVVSCNSTHVCVTGSTQNPWNLPTASQSQA
KRFYQDFFAPTVSITKIVKTINFLRE

Enzyme Prediction     

No EC number prediction in KAF7623710.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	5.01e-63	46	262	1	212	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	3.94e-22	34	253	42	257	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	2.50e-18	51	235	2	179	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133057	CESA_NdvC_like	5.30e-17	52	248	4	196	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
236918	bcsA	9.98e-15	46	238	260	442	cellulose synthase catalytic subunit; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD91169.1|GT2	9.33e-190	1	261	1	261
QMW34845.1|GT2	1.18e-179	14	262	47	295
QMW46918.1|GT2	1.95e-178	14	262	47	295
BCS08720.1|GT2	4.30e-78	36	260	74	300
BCR96204.1|GT2	4.30e-78	36	260	74	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	4.92e-13	46	248	273	469	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	2.03e-10	35	228	117	323	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.10e-10	35	228	129	335	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.10e-10	35	228	130	336	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58931|BCSA_PSEFS	5.05e-15	43	238	156	341	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|P58932|BCSA_XANAC	6.74e-15	42	249	149	350	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|Q6Z2T9|CSLA6_ORYSJ	8.38e-14	41	240	136	337	Probable glucomannan 4-beta-mannosyltransferase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA6 PE=2 SV=2
sp|Q9WX75|BCSA5_KOMXY	8.63e-14	46	230	146	324	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	8.63e-14	46	230	146	324	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF7623710.1.